(data stored in ACNUC7421 zone)

EMBL: CP000675.PE291

CP000675.PE291       Location/Qualifiers
FT   CDS_pept        complement(307574..307927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54291"
FT                   /protein_id="ABQ54291.1"
FT                   /translation="MNIIKVSEKKEMNISLHPMKKIEVIVSGDNENMVATMMEKANISG
FT                   FTLLRNVSGKGHHGFHEGKVLFNDKASFVMFIAVASEEAIANIALGMKTLFQKNSGVLF
FT                   VSDVSVARVDYFS"
     atgaatataa tcaaagtatc agaaaaaaaa gagatgaaca tctctttgca tccgatgaaa        60
     aagatcgaag tgatcgtatc tggtgacaat gaaaatatgg tcgctaccat gatggagaag       120
     gcaaatattt ctggttttac cttattgcga aacgtctctg gaaaaggaca tcatgggttt       180
     catgaaggta aagttttatt taacgacaaa gcctctttcg tcatgtttat tgcagtggca       240
     tctgaggaag ctattgctaa tattgcgctt ggcatgaaaa ctctattcca aaagaactca       300
     ggagtcctgt ttgtgtcgga tgtttctgtt gctagagtcg attatttctc ttag             354
//

If you have problems or comments...

PBIL Back to PBIL home page