(data stored in ACNUC7421 zone)

EMBL: CP000675.PE292

CP000675.PE292       Location/Qualifiers
FT   CDS_pept        complement(307941..310229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54292"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA92"
FT                   /protein_id="ABQ54292.1"
FT                   /translation="MSSHITLIKTNTNNENQMTQFNYKVDNDVMIIRAMVNNVAKQITP
FT                   VWPLEKFIACNSLHGFESMSFEEAVIQNQTAKKGTPFNEKLERVNWHMIKWCGSFLDIG
FT                   QGTLEMPHRDKGLYFGFLKLAPFDSELHQNNKSTKSWLSNLPEMPEQAIRLCLNKLGVL
FT                   NQKQEKFLKSTLSHLPGWAGYIKWISEWKNRNGKEENPVSLADFLAVRLIITCVLWPEA
FT                   SQEEKKKKKDNAYTKQLIQNIKNKEDDYRQLLLNKLLPELDKVQIKENRANAQMVFCID
FT                   VRSEPFRRCIEKLGHYETLGFAGFFGLPVSIKDYDGETIKDSCPVLLKPRFNIHEKAIA
FT                   ANEHCIEHHEKGKEFKNILNRIYQQLKYNFSTPFALVESLGIWCGITMFLKSCSPIFAR
FT                   RLTKDLNEMICPSIQTQPVFELDLLEKEVGISLQEQIAYAEMALRLMGLTDNFAKLVIF
FT                   CGHGSSTQNNPYASALDCGACGGNQGGKNAQLLASILNKIIVRRALAENGINIPQDTLF
FT                   YGAQHDTTTDEVEIYHSNVSQFIHQDILDQLRTDLNIAKHNNNLERINYLNSIDCAEKD
FT                   IARRSTDWSETRPEWGLARNAAFIVAPRQLTKNINLEGRCFLHSYDWSQDKDGALLETI
FT                   LTAPMVVAQWINTQYLFSTIDNVAYGSGSKITHNVAGKIGVMQGNASDLMHGLPLQSVM
FT                   SHDDKSFHEPQRLLTLVYAPREIISELVEKHDVLKTLFFNEWVHLVAIDPRSHLFYKLE
FT                   KTNTWSVIQ"
     atgagtagcc acatcacact aatcaaaact aacacgaaca atgaaaatca aatgacccaa        60
     tttaactaca aagtcgataa tgatgtcatg attatccggg ctatggtaaa taatgttgca       120
     aagcaaatta cgcctgtatg gcctttggaa aaatttattg cctgcaattc cttgcatggt       180
     tttgaatcca tgtcctttga agaggctgtg atacaaaacc aaacggccaa aaaaggcact       240
     ccattcaatg aaaaactgga aagagtcaat tggcacatga tcaaatggtg tggcagcttt       300
     ctagacattg gacaaggcac gcttgaaatg cctcatcgtg acaaaggctt atattttggt       360
     tttttaaagc tagccccttt tgacagcgaa ctgcatcaaa acaataaatc aacaaagagc       420
     tggttatcaa acctgccaga aatgcctgaa caagctatcc gactttgcct caacaaactt       480
     ggtgtattaa accaaaaaca agagaaattt ctcaaatcca ctctgtctca cttacctgga       540
     tgggctggat acattaagtg gataagcgaa tggaaaaatc gcaatggcaa ggaagagaat       600
     cctgttagcc ttgccgattt tcttgcagtg aggctgataa ttacctgcgt attatggcca       660
     gaagcaagcc aggaagaaaa aaaaaagaaa aaagataatg cgtatactaa acaacttatt       720
     caaaatataa aaaataaaga agacgattac aggcaattgc ttttaaacaa gcttttgcct       780
     gaattagaca aagttcagat aaaagaaaac agagctaatg cccaaatggt tttttgtatt       840
     gatgtacgct cagaaccatt tcggcgttgt atagaaaaac tggggcacta tgagacgttg       900
     ggatttgcag gattctttgg tttacctgtg agcatcaagg attatgacgg tgaaacaata       960
     aaagactcct gcccagtcct attaaagcca cgatttaata tccatgaaaa agcaattgct      1020
     gcaaatgaac actgcataga gcatcatgag aaaggtaaag aattcaaaaa tattttgaac      1080
     cggatctatc agcaattaaa atataatttt tcaaccccat ttgccctggt agaatcatta      1140
     ggaatttggt gtgggattac tatgttcctt aaatcatgta gcccaatttt cgctagacgc      1200
     cttaccaaag acctaaatga aatgatatgc ccctccattc aaacgcagcc tgtttttgaa      1260
     ttggatttat tagagaaaga ggtagggatc tcacttcaag aacaaattgc ctatgctgaa      1320
     atggcattga ggcttatggg actaactgat aactttgcca aacttgttat tttctgcggt      1380
     catggcagct ctactcaaaa taacccttat gcttcggccc tggattgcgg cgcttgtgga      1440
     ggtaatcaag gtggaaaaaa tgcgcaatta ctggcgtcta tcctcaataa aataatagtg      1500
     agaagggctc tggcagaaaa tggaatcaat attcctcaag ataccctgtt ttatggcgcg      1560
     caacatgaca cgacgacaga tgaggttgaa atttatcact caaatgtcag tcaattcatt      1620
     caccaagata tcctggacca gcttagaact gacttaaaca tagctaagca caataacaat      1680
     ttagaacgaa ttaactattt gaattccata gattgcgcgg agaaagacat tgcaagaaga      1740
     agcacagatt ggtctgaaac aaggccagaa tgggggcttg ctcgcaatgc cgctttcatc      1800
     gtagcacctc gccaactgac caaaaacatt aacctggaag ggcgttgttt cttacattct      1860
     tatgactggt cccaagacaa agacggcgcc ctgcttgaaa ccattttgac tgcacccatg      1920
     gtggttgccc aatggattaa tactcaatac ctgttttcaa caatcgacaa cgtggcatat      1980
     ggaagtggca gtaaaattac tcataatgtc gcaggaaaaa ttggagtcat gcaaggcaat      2040
     gccagtgatt taatgcatgg attgccactg caatctgtca tgagccatga tgacaaatcc      2100
     tttcatgagc cacaacgcct gttaactcta gtctatgctc ctcgcgaaat catcagtgaa      2160
     ctagttgaaa aacacgatgt tttaaaaacc ttgtttttta atgaatgggt tcatttggta      2220
     gcgattgatc cgcggagtca cttgttttac aagttagaga aaaccaatac ctggtctgta      2280
     attcagtga                                                              2289
//

If you have problems or comments...

PBIL Back to PBIL home page