(data stored in ACNUC7421 zone)

EMBL: CP000675.PE296

CP000675.PE296       Location/Qualifiers
FT   CDS_pept        314345..315331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0301"
FT                   /product="RND efflux membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54296"
FT                   /protein_id="ABQ54296.1"
FT                   /translation="MKLHAYSMISKLPKPQKIAKIIFIVFVAIILFLSFTPWQQFALGN
FT                   GKVIAFSPTERQHTVNSPVSGRIKKWYVDEGMRVKPGDPIVDITDNDPELLSRLEVEKK
FT                   AILLRIEAAKQAIAAGKANVDRQKKLYEQGINSRRQYELAQIEYAKYQNDLAQANIDKV
FT                   NVDVRIARQKTQIIKAHVAGIIFRRLTGQESVVVNAGDVLAQILPETESRAVELWVDGN
FT                   DIPFVRLNQKARLQFEGWPAIQFRGWPEIAVGTFGGTVSFIDPTDNGFGLFRVVIVPNE
FT                   PWPSVRFLRQGVRVHGWIQLGQVPLWYELWRQYNGFPPESNRENKAS"
     atgaaattac atgcttattc tatgattagt aaacttccca agcctcaaaa aatagcgaaa        60
     ataattttca ttgtttttgt tgccattatt cttttcttaa gttttactcc gtggcaacag       120
     tttgcattag gcaacggaaa agtcatcgcc ttttcaccaa cagagaggca gcatacggtt       180
     aattcacctg ttagcgggcg aataaagaaa tggtatgtcg acgaaggtat gcgtgttaaa       240
     ccaggagatc caatagtcga tattaccgac aatgatccgg agcttttgtc acgtcttgaa       300
     gtcgagaaaa aggcgatttt gcttcgtata gaagcagcca aacaagctat tgctgcaggt       360
     aaagccaatg ttgacagaca aaagaaattg tatgaacagg gaattaactc gagaaggcaa       420
     tatgaattgg cacaaattga atatgcaaaa taccaaaatg accttgcgca ggcgaatatt       480
     gacaaagtga atgtcgatgt ccgaattgct cgtcaaaaaa cacaaatcat taaggcccat       540
     gtcgcaggta tcatctttag acgtttgaca ggtcaggaaa gtgtcgttgt caacgcaggc       600
     gatgtattgg ctcaaattct gcctgaaaca gagtctcgcg ctgttgaatt atgggttgat       660
     ggcaatgata tacctttcgt acgccttaat caaaaagccc gtttgcaatt tgaaggatgg       720
     cctgctattc aatttcgcgg atggccagaa attgcagtcg gaacatttgg aggtacagtc       780
     tcctttattg atcctacgga taatggcttt ggcttattcc gtgtagtgat tgttcctaat       840
     gagccatggc ctagtgtgcg ttttttacgg caaggagtgc gggtgcatgg gtggatccaa       900
     ttgggtcaag ttcctttatg gtatgagctt tggcgtcagt ataatggttt cccaccggaa       960
     agtaatcgcg agaataaagc atcatga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page