(data stored in ACNUC7421 zone)

EMBL: CP000675.PE306

CP000675.PE306       Location/Qualifiers
FT   CDS_pept        complement(332014..332496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54306"
FT                   /protein_id="ABQ54306.1"
FT                   /translation="MATYYGQCACGKIQFICTGEPVFTQYCHCNKCREIASLSQKKQDK
FT                   SGYSLTAAYLTRDFRIVSEENDFEEIIKEKAKLFLCSYCHSLVYGISLDPRQQDSIGIN
FT                   VNNFKFDTNIPDSFKPIRHIWYACRIMDCDDQLPKFKDAPKEQFGSGELFELPNAN"
     atggcaactt attatggtca atgcgcttgt ggaaaaattc aatttatatg tacaggtgag        60
     cctgtcttta ctcaatattg tcattgcaat aaatgtcggg aaattgcttc tttatctcaa       120
     aagaaacaag ataaatcagg ctactccctc actgcggctt atttgaccag agacttcagg       180
     atcgtgtctg aggagaatga ttttgaagaa atcattaaag aaaaggcaaa gttatttctt       240
     tgctcatatt gtcacagcct tgtttatggt atttcacttg atcccaggca acaggatagt       300
     attgggatta atgtaaataa ttttaaattt gatacaaata tcccggattc atttaaaccg       360
     ataaggcaca tatggtatgc ctgccgtatt atggattgcg atgatcaact gcctaaattt       420
     aaagacgctc ccaaagagca gtttggttca ggggaattat ttgaattgcc taatgccaac       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page