(data stored in ACNUC7421 zone)

EMBL: CP000675.PE307

CP000675.PE307       Location/Qualifiers
FT   CDS_pept        complement(332590..334569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54307"
FT                   /protein_id="ABQ54307.1"
FT                   /translation="MRYVNFELLKRIPQHLKGVMEYYPDVLLFQLNQIQYTHLWHELSS
FT                   AKYLYTNGFVIKPTHWLMYAFQTVKGWLGFDNHCQREKISYVLNKLSYYGYTKQFLQPD
FT                   FSSITNFSISPEISALVVKSRDDLTTAQLQNKLVNNYFKVEPHLGIDYSYQKLNPNHRF
FT                   GESWTHAHEWGLIPQLDPQDDSLIAEVISTLDKNGISAKDVFFLQHSKYAKAAAQYYCD
FT                   KAKNTIVPSFFFRLLWTDPRPRYLALALAYDPEIAKRDAQKFIEYHLAQKEYDNAFNLL
FT                   GILNDSNLVLKFLLAIPETERHALIQKDTAIAAIMAKYYIEKKQYLLATQFYTNIEEIS
FT                   PNAAFAIEIQEQNYEKAYDIFKKYNSPDLFSMPERKSLAKIFYSEAETAYVAGKTYRGN
FT                   KSWEKAKQYYLQSLEQKKAAHHLDPSDEYLEDLYVHKRLYALLLIDADIDLHKAEDSDI
FT                   ASIQKAITLLRECRSNNKEEQEHHKRALAAGLMRRVDTLREKIAFNYYSSDFESIRKHK
FT                   IEHQQDIAILIKTLGELIALLEGTQDKALRLQLGKAHYLLADVQCFFDINAPDINQHYK
FT                   MAMKAVPGNPFYVLRVAELFEEEKSKLQKIGIIQLKNMGYQVFDFLHWSEERWCKRDDI
FT                   IHNIKDIHMPPAEPINSSSWNFTF"
     atgcgttatg ttaattttga attattaaag agaatccctc agcatcttaa aggggttatg        60
     gaatactacc cggatgtgct tctgtttcaa ttgaatcaaa tacagtatac ccatttatgg       120
     catgagttat cttccgcaaa atacctctat actaacggat ttgtgataaa acctacccat       180
     tggttgatgt atgcctttca aacggttaaa ggctggcttg gctttgataa tcattgtcag       240
     cgagagaaaa tttcatacgt tttaaacaaa ctctcgtatt atggatatac gaaacaattt       300
     cttcagcctg atttttcatc aataacaaat ttctcaatct ctcctgaaat ttctgccctg       360
     gttgtcaaaa gcagagatga tttaacgaca gcccagctac aaaataaatt ggtgaataat       420
     tattttaaag tggagcccca tcttggaatt gattattcct accagaaact aaaccccaat       480
     catcgctttg gtgaaagctg gacgcacgca cacgagtggg gactgattcc gcaattagac       540
     cctcaagatg acagcttgat cgcggaggta atcagcaccc tggataagaa tgggatttca       600
     gcaaaagatg tgttcttttt gcaacatagc aaatacgcca aagctgctgc tcagtactat       660
     tgtgataagg ctaaaaatac aattgtccct tccttttttt tccgcttgct ttggaccgac       720
     ccgcgccctc gctatctcgc tttggccctt gcttacgatc ctgaaatagc caagcgggat       780
     gcccagaaat tcattgaata tcatcttgcg caaaaggaat atgacaatgc gtttaatcta       840
     ttgggcatat tgaacgactc caatctggtt ttaaaatttt tgttagcgat tccagaaaca       900
     gaacgtcatg ctttaattca aaaagacaca gcaatcgccg ccatcatggc aaaatattat       960
     attgaaaaaa aacaatatct cctggcaaca caattttaca ccaatattga agaaattagc      1020
     cctaatgcag catttgctat tgaaattcaa gagcaaaatt atgaaaaggc ttatgatatc      1080
     tttaagaaat acaattcccc tgacctattt tcaatgcctg agcgtaaatc gcttgccaag      1140
     atattttata gtgaagctga aacagcctac gtagccggga aaacatatag aggaaataaa      1200
     agttgggaaa aagcaaaaca atattatctg caaagcctgg agcaaaaaaa ggcagcacac      1260
     cacctggatc cctctgacga atacctggaa gatttatacg ttcacaagcg cttatatgcc      1320
     ttgttattaa tcgacgcgga tatcgacctg cacaaagcag aggacagcga tattgccagc      1380
     atccaaaaag caatcactct gttgagggaa tgccgctcaa acaataaaga agaacaagaa      1440
     catcataagc gcgccctggc agccggactt atgcgccgag tagatacttt gcgtgaaaaa      1500
     attgctttta attattactc ttctgatttt gagtctatca gaaaacataa aatcgaacac      1560
     caacaagata ttgcgatttt aattaaaaca ttgggggagt taattgctct attggaagga      1620
     actcaagaca aagccttgcg cttgcaactg ggtaaagcac attatctcct ggccgatgtt      1680
     caatgctttt ttgatatcaa tgccccagac attaaccagc attataaaat ggcgatgaaa      1740
     gcagtaccag gaaacccctt ttatgtgcta cgcgtagcag agctatttga agaggaaaaa      1800
     agcaaactgc aaaaaatcgg cataattcaa ctgaaaaata tggggtacca ggtcttcgat      1860
     tttcttcact ggtctgaaga gcgttggtgt aaacgagacg atatcattca taatatcaaa      1920
     gatatccaca tgccgcccgc agaaccaatt aatagctcat catggaattt tacgttttaa      1980
//

If you have problems or comments...

PBIL Back to PBIL home page