(data stored in ACNUC7421 zone)

EMBL: CP000675.PE312

CP000675.PE312       Location/Qualifiers
FT   CDS_pept        complement(339289..339420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54312"
FT                   /protein_id="ABQ54312.1"
FT                   /translation="MHQPNMSFPAQVETPFYPGYQDRFIPEKIQEQIDENHYLSSLF"
     atgcatcaac cgaatatgtc ttttcctgct caagtagaaa cccctttcta ccctggctac        60
     caagaccgat ttattcctga aaaaattcag gaacaaattg atgagaacca ctatcttagt       120
     tcattatttt ga                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page