(data stored in ACNUC7421 zone)

EMBL: CP000675.PE313

CP000675.PE313       Location/Qualifiers
FT   CDS_pept        339669..340478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54313"
FT                   /protein_id="ABQ54313.1"
FT                   /translation="MSKGKILSYAVMTIISSTALAGAMGETKTCPDLGCMPWFVEFGTG
FT                   VSWSTKSHINPDPSRWDPANEGYNSTLGNEPLYMAGIGYTINPLLSVDANYTFRGIYKY
FT                   RKHQTALGASAVNPLGNKTRYFDLISNSLMFSGTLYGQGWSENLAYSMGNYGIIQPFLG
FT                   GGVGVAYNTVSNFRTVTDNTNFVTSVLQDYTKASFAWQLNAGLELKKNRFGLDLGYRYF
FT                   NAGSFLSNNALITRVNSVGTPITTNLIPAWSSNLSANELYLTAKIAF"
     atgtcaaagg gtaaaatttt aagttacgct gtaatgacaa tcatatcgag tactgcattg        60
     gcaggagcaa tgggtgaaac caaaacatgt cctgatctcg ggtgcatgcc ttggtttgta       120
     gaatttggga ctggtgtcag ttggtctact aaatctcata ttaatcccga tccaagtcgt       180
     tgggatcctg ctaatgaagg ttataacagc actctaggta atgaaccttt atatatggca       240
     ggtatagggt atacaatcaa tccattgctc tctgttgatg caaactatac tttccgagga       300
     atttataaat atcgcaaaca tcaaactgct cttggagcca gtgctgtgaa ccctttaggc       360
     aataaaacgc ggtattttga tttaataagc aactccttaa tgtttagtgg tactttatac       420
     gggcaaggat ggtcagaaaa tcttgcttat tcaatgggta attacggtat cattcagcct       480
     tttttgggtg gtggggtcgg cgtcgcttat aacactgtca gtaactttcg tacggttaca       540
     gacaatacaa attttgtgac tagtgtattg caagattaca caaaagcatc tttcgcttgg       600
     caattaaatg ctggtttgga attgaaaaag aatagattcg gccttgattt aggatatcgt       660
     tactttaatg caggttcctt tttatctaat aatgcgttga ttacccgggt aaatagtgta       720
     gggacaccta tcactacgaa tcttatccct gcatggtcta gtaacttatc agcaaatgaa       780
     ctttatttga ccgccaaaat tgctttttaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page