(data stored in ACNUC7421 zone)

EMBL: CP000675.PE318

CP000675.PE318       Location/Qualifiers
FT   CDS_pept        347742..348314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54318"
FT                   /protein_id="ABQ54318.1"
FT                   /translation="MLFQPVTASFSMLVAGAFAQLLVPYSIFMLCMGEAGFAGRTLINY
FT                   FEITIVALAMPFIALLSTVGRCIATVKCLVEDQYNLAEMVEDKEVKPNKIYLDCAEVNY
FT                   TVRDENNNQFIRKYYKFQYKMRGLNDELCQGIFTFRDLERAPDNDDFNGKLSSLTLYKY
FT                   DILDLIKRVHKDKFEEMEDENLIRISI"
     gtgctattcc agccagttac tgcttctttt tcgatgctag tcgcgggggc atttgcacaa        60
     ttactggtgc cctattccat tttcatgctc tgtatggggg aggctgggtt tgcgggcaga       120
     acattaatta attattttga aataactatt gttgctttgg caatgccatt tattgcttta       180
     ttaagtactg taggccgatg tattgcaacg gttaaatgcc tggttgaaga tcaatacaat       240
     ttggctgaga tggttgaaga caaagaggtt aagccaaata aaatctatct tgattgtgct       300
     gaagtaaact acactgtcag ggatgagaac aacaatcagt tcatccgcaa atattataaa       360
     ttccaatata aaatgagagg tctcaacgat gagctttgcc agggaatctt tactttcaga       420
     gatttagagc gtgctcctga taatgacgat ttcaatggaa agctttccag tctcacactt       480
     tataaatacg acatcctgga tttgattaaa agagttcata aagataaatt tgaagaaatg       540
     gaagacgaaa atctaattcg tatatccatt taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page