(data stored in ACNUC7421 zone)

EMBL: CP000675.PE319

CP000675.PE319       Location/Qualifiers
FT   CDS_pept        348554..349507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54319"
FT                   /protein_id="ABQ54319.1"
FT                   /translation="MRLSYGLLGFMIFNLVACEKMALLTTPPKKQQLSNSPLATRAERY
FT                   FWRTLHEGRYQDIPQADYLLMAAYLENPYDSKLAAHLGFIHIWKITERERVKNNSPLLP
FT                   NEIILSKKYFADALQLDPENPIYQGFYGDTQLVEGQIFKDKQEEVRGYFTLQKAISNWP
FT                   EFNYFTAGYPMSSLSADSDHFKKGLDWQWKTLDICAGEKISRQNPDFTPYMKRETTIGT
FT                   QRACWNSEIAPHNFEGFFMNMGDMLVKSGDPETGIKIYNNAKLAKNYNKWPYKDMLEKR
FT                   VLNAKANVQHFNQKSNDPNQSIMFNSGYGCVVCHQR"
     gtgcgtttat cttatggctt gttaggtttc atgatattta atttggtggc ttgtgaaaaa        60
     atggcattac tgactacgcc acctaaaaaa cagcaattat ctaatagtcc actggctact       120
     cgggcagagc gatatttttg gcgaaccctt catgaggggc gatatcagga cattccccaa       180
     gcggattatt tgctgatggc agcttacctc gagaatccgt atgattcgaa attagcggcc       240
     catcttggtt ttattcatat ttggaaaatt acggaacggg aaagagtaaa aaataactct       300
     cccttgctcc ccaatgaaat tattttgtct aaaaaatact ttgctgatgc tctgcaactg       360
     gatccggaaa acccaattta tcaaggattt tatggcgata cccaattagt agaagggcag       420
     atttttaaag acaaacaaga agaagtcagg ggatacttta ctttacagaa agcgataagc       480
     aattggcctg aatttaatta ttttactgca gggtacccca tgagtagttt aagtgctgat       540
     tcggatcatt ttaaaaaggg tttggattgg caatggaaaa ctttggatat ctgtgctggt       600
     gagaagatta gtagacagaa tcctgatttt acgccttata tgaagaggga aacaacaata       660
     ggcacgcaaa gagcctgttg gaattcagaa attgcgcctc ataattttga aggttttttt       720
     atgaatatgg gggatatgtt agttaaatcc ggagatcccg aaacagggat aaaaatatac       780
     aataatgcca aattggctaa aaattacaat aaatggccgt ataaagacat gttggagaaa       840
     cgtgttctga atgcgaaagc caatgtgcaa cattttaatc aaaaatccaa tgaccctaat       900
     cagtcgatta tgtttaattc gggatatgga tgcgtggttt gtcatcaacg gtaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page