(data stored in ACNUC7421 zone)

EMBL: CP000675.PE324

CP000675.PE324       Location/Qualifiers
FT   CDS_pept        353394..354071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0329"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54324"
FT                   /protein_id="ABQ54324.1"
FT                   /translation="MKAKGFFDEQSSLQKSKIGLNLVWMFSLGHIFLITLSNVLVQYPF
FT                   AMMGFHTTWGAFTYPAIFILTDLTTRIATANKARKIIMLSMTPGLILSYLVASYIEAGN
FT                   NLNENGLSVLHLMPLRIALACFIAYVVGQLLDVAVFQRYRNRPAWWLAPTLSAVAGNFI
FT                   DTALFFTIAFYHCSNPFLSQNWPEIAMVDVFFKIMISLIAFVPVYGLVLSILGIKTTNK
FT                   LMV"
     atgaaagcga aaggtttttt tgatgagcaa tcttccctgc agaaaagtaa aattgggttg        60
     aatttagtat ggatgttctc acttggtcat atttttctaa taacgctcag taatgttctg       120
     gttcaatatc catttgcaat gatgggattt cacacgacct ggggggcgtt cacttatcca       180
     gcaattttta ttttaactga tttgacaaca aggatagcaa ccgctaataa ggcgcggaaa       240
     attattatgc tgagtatgac cccaggatta atattgtcct atcttgttgc gagctatatt       300
     gaggcaggca ataatttgaa tgagaacggt ctatccgttt tacacctcat gccattacgt       360
     atcgccctgg cttgttttat agcctacgtt gttgggcaat tgctggatgt ggcagttttc       420
     caacgctata gaaatcggcc tgcctggtgg ctggccccaa ctctatcggc ggttgcaggc       480
     aatttcatag atacggcatt attttttact atcgcgtttt atcactgctc caatccattt       540
     ttaagtcaga attggcctga aattgcgatg gtcgatgtct tttttaaaat catgattagt       600
     ttaattgctt ttgttccggt ttatggtttg gttttaagta ttcttggtat aaaaactacc       660
     aataaattaa tggtataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page