(data stored in ACNUC7421 zone)

EMBL: CP000675.PE326

CP000675.PE326       Location/Qualifiers
FT   CDS_pept        354882..355409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54326"
FT                   /protein_id="ABQ54326.1"
FT                   /translation="MYNKMFKPLDTDPILYFKMYSNYTEGRVDDCCAFILMPSGLQREW
FT                   VCLQSIQFAFNKRGDVLGINIIFSGNESNIHKKVRETMEGMLKLKLQYGRGEELFVFDE
FT                   EKKTFHMGIVPGKDTQAYLEGIIAFIKDSYRLQPDFAQDIKSQLLSKEYLAQEYSRLRW
FT                   KPPEKETVCVLM"
     atgtacaaca aaatgtttaa gcctctggat actgacccga ttttatattt caaaatgtac        60
     agtaattata ctgagggaag ggttgatgat tgttgtgcat ttattttaat gcccagtggg       120
     ttacaaagag aatgggtctg tttgcaatcg attcaatttg cttttaataa gcgtggtgac       180
     gtccttggga ttaacattat tttttctgga aatgagtcga atatccacaa aaaggttcga       240
     gaaacgatgg aagggatgct caagctgaag cttcaatatg gaagagggga agagcttttc       300
     gtttttgatg aagaaaagaa aacatttcat atggggatag ttcctggtaa ggatacacag       360
     gcgtatttgg agggcattat cgcttttatt aaggatagtt atcgcttgca accggacttt       420
     gcccaagaca tcaagtcaca acttcttagt aaggaatatc tggcacagga atatagtcgt       480
     ttgcgatgga agccaccaga gaaagaaact gtttgtgtgc ttatgtag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page