(data stored in ACNUC7421 zone)

EMBL: CP000675.PE327

CP000675.PE327       Location/Qualifiers
FT   CDS_pept        355564..356910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0332"
FT                   /product="outer membrane channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54327"
FT                   /protein_id="ABQ54327.1"
FT                   /translation="MYRKRWLILLCALLNNGCLWLGSEYRKPHVNTPQKWPHKYSIQTE
FT                   QAAYLPDLHWWKQFNSKELNASIQKALQNNHQIHLAMANIESAQGQLRQVQLSWLPNLT
FT                   GLAGYTQFPVLGNPGTTAIAYPAYIINIFQQYKQQKSAQAMLEASIYAQYSARLVVIAQ
FT                   TAASFFTLVAQNEALHLYNKLLKDYRTYLKLTQSQYRSGLISLDNITQIKSHIQRIEAQ
FT                   IKVVQHNIVVTKNALHFLFNENPGDVETKTLFENIDSNQLVPGNLPASVLRVRPDIHEA
FT                   EALLKAAHADVGAIAANLLPGINLGAYLGEGSNVDGAIKLGQAYLNGPIIDLPLFAQVD
FT                   VSKARYKAIYIKYITTIRKALRDVANDLSAYSTSSQQLNNNLSALSDEKQQCHLAEVRY
FT                   RHGIDDYLNLIKCQILLDEFKLVINQNKLEKLLSIVALYQDLGGGYRGH"
     ttgtatagga agcgatggct cattttattg tgtgctttgt tgaataatgg ttgcctctgg        60
     cttgggtcag aatacaggaa acctcatgtc aacaccccgc aaaaatggcc gcataaatat       120
     tcaattcaaa ctgagcaagc tgcctattta cctgatctgc attggtggaa acagttcaat       180
     agcaaggagc tcaatgcttc tatccaaaag gcattacaaa ataatcacca gattcacctc       240
     gctatggcaa atattgaatc cgcacagggg caattgcggc aagtccagtt aagttggttg       300
     cctaatctca cagggcttgc aggctacacc cagtttcccg ttttaggtaa tccggggact       360
     acggcaattg cctatccagc ctacatcatt aatattttcc agcaatataa gcaacaaaaa       420
     agcgcgcaag ccatgcttga agccagtatt tacgcgcaat attctgccag actggtcgtg       480
     atagcccaga ctgcagccag cttttttacc ttggttgctc agaatgaagc tttgcattta       540
     tacaataaac tgcttaagga ttatcgaacc tatctcaaac tgactcaaag ccaatatcgc       600
     tcaggattga tttcgcttga taatatcact caaatcaaaa gtcatatcca acgaattgag       660
     gcacagatca aggtggttca gcataacatt gtggtgacta aaaacgcctt gcatttttta       720
     tttaatgaaa atcctggaga tgtcgagact aaaactctct ttgaaaatat cgatagtaat       780
     caattggtac cagggaattt acctgccagc gttctcagag tgagacctga tattcatgag       840
     gcagaagcgt tgttaaaagc agcgcatgcc gatgtgggtg cgatagccgc gaatctttta       900
     ccagggatta atttgggcgc ttacctgggt gagggatcta atgtggatgg cgccattaaa       960
     ttagggcaag cttatttaaa cggcccgata attgatttgc ctctatttgc tcaggttgat      1020
     gtgagtaaag ctcgatataa ggcaatctat atcaaataca ttactactat tcgtaaggcc      1080
     ttgcgtgatg ttgctaatga cttgtctgcc tattcaactt ccagccagca attaaataat      1140
     aatttatcgg ctttaagcga tgaaaaacag caatgccatt tggcagaagt tcgttatcgt      1200
     cacggaattg atgattattt aaatctaata aaatgccaaa tcctgttaga cgaatttaag      1260
     ttggtgataa accagaacaa gctggaaaaa ctgctatcca tagtcgcttt ataccaggat      1320
     ttaggaggtg gataccgtgg gcattga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page