(data stored in ACNUC7421 zone)

EMBL: CP000675.PE328

CP000675.PE328       Location/Qualifiers
FT   CDS_pept        356900..357937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0333"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54328"
FT                   /protein_id="ABQ54328.1"
FT                   /translation="MGIDQQKTVRTLRLSLTCIFLFLITWYYQVPESAWTLVTIWFVMY
FT                   EYSTVGGVLTKSFLRFAGTALSAIYGMIVVYFCANNPLINIMALVPGLFLYAYFFMGGD
FT                   KTYIGTIGAVTLTIVLLNYNDIDTAVLRVFNVIIGVIGSMFMIRFFYPQYARDKVLEIQ
FT                   LNFITQLANLLESYLNPTQPLAAIQTKYLDYERKMLDGFTLYNRYIGEAKIEAKKAPFF
FT                   IPHSIAAMQHFRRLFRLFSVFVYYLSTEEIRSDPWVCDQLSKLLLNLQSLQRKLLKQDA
FT                   GPIGGDVVAAEPEEEIVIETPNIENKIATEAIVNNMQKEIALLDAEIKEIILIYDVYDI
FT                   RLNEM"
     gtgggcattg atcagcaaaa gaccgtccgt accttgcgct tatccctgac gtgtattttt        60
     ctttttctca ttacctggta ctaccaagtc ccagaaagcg catggacttt agtgaccata       120
     tggtttgtca tgtatgaata ttccaccgtt ggtggcgtac tgacaaaaag ctttttgcgc       180
     ttcgcaggca cggctttgag tgccatctat ggaatgatag ttgtttattt ttgtgccaat       240
     aacccgttga ttaacattat ggctttagta cctggtttgt ttctttacgc ctattttttc       300
     atggggggag ataaaacgta tattggtacc atcggggctg taacgcttac tattgtattg       360
     ctgaattata acgacataga tacggctgtg ttgcgggtat tcaatgtcat tatcggcgtc       420
     attggttcta tgttcatgat ccggtttttt tatccccaat atgcaagaga taaagtttta       480
     gagattcagt tgaactttat tactcaactt gcaaatcttt tagaaagcta cctgaatcca       540
     acccagcctt tggcagctat ccagacaaag tatttagatt atgaacgcaa gatgcttgat       600
     ggttttactt tatacaatcg ttatattggc gaagccaaaa tagaagcaaa aaaagctccg       660
     tttttcatcc ctcattccat tgctgccatg caacatttca ggcgtctgtt tcgtttgttc       720
     agtgtgtttg tttattattt atctactgag gaaattcgat cggatccatg ggtatgtgat       780
     caattaagta aacttctgct taatttacag tcactgcaac gaaaattgct gaaacaggat       840
     gcggggccca tagggggaga cgttgtggct gcagagccag aagaagaaat cgttatagaa       900
     acacctaata ttgaaaataa aatagcaaca gaagctattg tcaataatat gcagaaagaa       960
     attgctttgc ttgatgctga aattaaggaa ataatattaa tttacgatgt ttatgatatc      1020
     aggttgaatg agatgtaa                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page