(data stored in ACNUC7421 zone)

EMBL: CP000675.PE329

CP000675.PE329       Location/Qualifiers
FT   CDS_pept        357994..358986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0334"
FT                   /product="multidrug resistance secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54329"
FT                   /protein_id="ABQ54329.1"
FT                   /translation="MSDKPKAGFPVIILLCVFLFILIYHYSYLFPFTNNAFVVANVRPV
FT                   AANVKGYITNIYVKNEQEVKKGQPLFTVFKAPYELAYRKAVSDVQEAKAQLLLFNKQVE
FT                   KTKYLLQAQKELYEKFRFDYEHNHSALRDHAVSKLTVNTMLKEKNAALSKLKALEKELE
FT                   VNQQQVIVQKKKIDSLIAVMKNAKIDLDETTVYAKQNGAVQDMFVALGTPIKTRKPVFA
FT                   IADTDTLFIQANFNETDLRRVQPGDKVSIFPRMYFGSKIYHGVILSRNWAASRLETHRA
FT                   TQIQIVRNSESNWFLLPQRLPVQIQITDYDPVHYPLSIGASAYVYIHTH"
     atgagtgaca aacccaaagc tggattccct gtaattattt tattatgcgt gtttctattc        60
     attctgattt atcattactc gtatttattt ccttttacaa acaatgcatt tgttgttgcg       120
     aatgttcgtc cagttgctgc caatgtaaaa ggttatatca ccaatattta tgttaaaaat       180
     gaacaggaag taaaaaaagg ccaaccatta tttaccgtat tcaaagcccc ctatgaattg       240
     gcctacagga aagctgtgag cgatgttcaa gaggcgaaag cccaattatt gttattcaat       300
     aaacaagttg agaaaacgaa atatctgctg caagcacaaa aagagcttta tgaaaaattc       360
     cgctttgatt atgagcataa tcattctgcc ttgcgtgatc acgcagtttc taagctgacc       420
     gtcaatacga tgttaaaaga aaaaaatgcg gcactaagca aattaaaagc attggaaaaa       480
     gagttggagg tcaaccagca acaagtcatt gtgcaaaaaa agaaaattga ctctttaatt       540
     gcggtgatga agaatgccaa aatcgatttg gatgaaacca cagtttatgc caaacaaaat       600
     ggggcagttc aggatatgtt tgttgcattg ggaaccccca tcaaaacccg aaaaccagtc       660
     tttgccatag cggataccga tactttgttt atccaggcta atttcaacga aacggattta       720
     agaagggtac agccagggga taaagtctct attttcccga gaatgtattt tggatctaaa       780
     atttatcatg gagtgattct ttccagaaac tgggctgcaa gccgcctgga aacccatcgg       840
     gcaacgcaaa tacaaattgt tcgcaatagc gaaagcaact ggtttttatt acctcaacgc       900
     ctgccagtac aaattcaaat aacagactat gacccggtgc attacccgtt aagtataggc       960
     gctagcgcct atgtgtatat ccatactcat taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page