(data stored in ACNUC7421 zone)

EMBL: CP000675.PE33

CP000675.PE33        Location/Qualifiers
FT   CDS_pept        complement(40290..41315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54033"
FT                   /protein_id="ABQ54033.1"
FT                   /translation="MGWTDRFWNAYRVVTNTVIEGAANSLNAAGSLACLLGGAGVSLSY
FT                   SMSETIKAGYFGSVGVAGTVNLDVTAVEFNYGFNQTIPFRRDLLEKSGGGSYALNDFAN
FT                   PGTIFMISSLAILSGTTLRTFGANLKKWQQNREDKYHFIAKYSTDLEPPSYKEYLYVNA
FT                   ESFFNSLAIASFSSLLAKNVLDFSIKDLSKYHFTYPFNGTNITGSVKTPDYTGPVTSEF
FT                   FPLDFFVSQNTTIHTDYFNLIVNEKVKANAMTNVTYGGGVHLEPSHQSSAPLLAASATI
FT                   GIGTYLAGTFFGKKILRERDERLQRSRSSSYSIVSGTFWDNKHDIEAKGDTKFEHTHSL
FT                   Q"
     atgggatgga ctgatcgatt ttggaatgcg tatcgcgtgg ttactaatac cgtaatcgaa        60
     ggcgcagcaa actctttaaa tgcagctgga tcactagctt gcctgctcgg aggcgctggg       120
     gtctctctct cttactccat gtctgaaaca ataaaagcag ggtacttcgg atcagttgga       180
     gtagcaggca cagttaattt ggatgtgact gcagtagaat ttaattatgg atttaatcaa       240
     accattcctt ttcgcagaga tttgctggaa aaatccggcg gtggcagcta tgcattgaat       300
     gattttgcca atccaggtac tatttttatg attagttctc tggctattct ttccggaacc       360
     actttaagaa cttttggggc taatcttaaa aaatggcaac aaaacagaga agacaaatac       420
     cactttattg ccaagtacag cactgacctg gaaccccctt cttacaaaga atatctgtat       480
     gtcaacgcag aatccttctt caattctttg gcaatagcct cattcagcag tcttttggca       540
     aaaaatgttc tggatttttc gattaaggat ttatcgaaat atcatttcac ctatcctttt       600
     aatggaacaa atataactgg ctcagtgaaa acgcctgatt atactgggcc agttacatca       660
     gaatttttcc cccttgactt ttttgtgtct caaaatacaa ccatccacac agattatttc       720
     aacctgatag tcaatgaaaa agtgaaggcc aatgcaatga ccaatgtcac ttatggtgga       780
     ggagtacatt tagagcccag ccaccaatca agcgcccccc ttctggctgc ttctgcaact       840
     attggtatcg gtacctattt ggcaggcact ttttttggca agaaaatcct gcgagaacgt       900
     gatgaaagac ttcaacgttc aagatcatcg agctattcca tagtttcagg cactttttgg       960
     gataataagc atgacataga ggcaaaaggc gatacaaaat tcgagcatac ccattcatta      1020
     cagtaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page