(data stored in ACNUC7421 zone)

EMBL: CP000675.PE330

CP000675.PE330       Location/Qualifiers
FT   CDS_pept        359162..361105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54330"
FT                   /protein_id="ABQ54330.1"
FT                   /translation="MKIPFEGKWRATITKREAGFSQRVVVGGATSGNGSYNGVVGNSFV
FT                   FEDGWVELQWNNNAGSGWQESAVISSVGMTSPLVVVKFVSADDNFPNQRDGDYDDLQVR
FT                   FEHLDAPFEVTQRPYALDRGSLVMFPDGIFDASQGIQYMGVRIKNTWFFDWQGNFPATG
FT                   MKIGIAPVSRSALSAAGIVVIDSWTPQEQEGLGQIMDGGFVRVPDLKINEETTIYFKLD
FT                   VSNANPSKPEIGFVAQRDAYDPRYDEPTRIVDKKIFISRSSYNPATRELVTAIPEGTLY
FT                   LKLNKIAIDRKGATKAAQELKKCLKQHGGGIKGMSKWLHKLSRGFWQNSKDKERWCKEQ
FT                   GNDALRKLLKQLLAGKDIDICHLKAILDQCCERPGGDCECCPCGDGDGRPGGWDDGTGV
FT                   DGWCRVKPVFWLPLDFEYKVVPNPAYIGQFGPLAFEDPWWKVVLIILAIILAIASVIYD
FT                   YVYASEDDQYIIGQVVRNGDAPINLVDAAVSNLNGSRGVDLGQLDAQGNDINNGSPITA
FT                   LDSIIQLDRTAAGSYFGTLDAVLGNVVWKSGATSATTRGFISTLGTSVSIPYDEHDTLS
FT                   GTVTYTNEVVISELAAIPQTLSDPGDSGSVWVDLATARPVALNYGSPTDSSDNRAFANP
FT                   IRSVIDVLNLRF"
     atgaaaattc catttgaagg gaaatggcgt gcgaccatta ccaaacgtga ggctggtttt        60
     agtcaacgtg tcgtggttgg aggcgcaacc agcgggaatg gcagttacaa tggtgttgtt       120
     ggcaacagct ttgttttcga agacggttgg gttgaactcc agtggaataa caacgcaggt       180
     tcaggctggc aggaaagcgc tgtcattagt tctgtgggaa tgacgagtcc gctagttgtt       240
     gtaaaatttg tttcagccga tgacaatttt ccaaatcaac gagacggcga ttatgatgat       300
     ttgcaagtcc gttttgaaca tcttgatgct ccttttgaag taacgcaaag accttacgct       360
     cttgatcgag gctcccttgt catgtttcct gacggcattt tcgatgcgag ccaggggatt       420
     caatacatgg gagtacgcat caaaaacacc tggttttttg attggcaagg taattttccg       480
     gcaacaggaa tgaaaattgg tattgcgcca gtgagtcgtt ccgccttgtc tgctgctggt       540
     attgtggtga ttgatagttg gacgccacag gaacaagaag gtttggggca aatcatggat       600
     ggtggctttg tgagagttcc tgatctaaaa attaatgagg aaacaacaat ttacttcaag       660
     ctggatgtca gtaatgccaa tccctccaaa cctgaaatcg gttttgtggc acagcgcgat       720
     gcttatgatc cacgctatga tgagccaaca cgaatagttg ataaaaaaat tttcatcagt       780
     cgctccagtt acaatcctgc aaccagggaa ttggtgactg cgatccctga aggtactttg       840
     tacctgaaac ttaataaaat tgccattgat cgcaaaggcg ctacaaaagc agctcaggaa       900
     ttgaagaaat gccttaaaca gcatggaggt ggcataaaag ggatgtcaaa atggctgcat       960
     aagctaagcc gtggtttttg gcaaaatagt aaagacaagg aacgttggtg caaggagcaa      1020
     ggcaatgatg cattacgtaa gcttttaaaa cagcttttag ctggaaagga cattgatatt      1080
     tgtcatctta aggctatttt ggatcaatgt tgtgaacgcc caggcggaga ttgcgagtgt      1140
     tgtccttgtg gtgatggaga tggcaggccg ggtggttggg atgatggtac cggggttgat      1200
     ggctggtgcc gagtgaaacc tgtattctgg ttaccgctgg attttgaata taaggtagtc      1260
     cctaacccgg cttacattgg ccagtttggt cctcttgctt tcgaggatcc ctggtggaaa      1320
     gtagttttaa tcatcttggc aattatactg gctatcgctt cagtcattta tgattatgtt      1380
     tatgcatcag aagatgacca atacattatt gggcaggttg tccgtaatgg ggatgctcca      1440
     atcaatctgg ttgatgcagc agtgagtaat cttaatggct ctcgtggagt ggatctggga      1500
     caactggatg cccagggtaa tgatattaac aacggcagcc ccattactgc attagacagt      1560
     attattcagc ttgatcgtac agcagccgga agttattttg gtacgcttga cgctgttttg      1620
     ggtaatgtcg tttggaagtc aggggctacc agtgcaacaa cgagaggatt tatcagtact      1680
     ctgggaactt ccgtcagcat accctatgat gagcatgata ccctttcagg tactgttact      1740
     tatactaacg aagtagttat cagcgaactt gctgcgattc cgcaaacact ctcagatcct      1800
     ggtgactcgg gatccgtatg ggttgatctg gcaacagcgc gtccagttgc tttaaattac      1860
     ggcagcccaa cagactccag tgataatcgg gcttttgcta atccgatacg ctctgttatt      1920
     gacgtgctta acttacggtt ttaa                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page