(data stored in ACNUC7421 zone)

EMBL: CP000675.PE332

CP000675.PE332       Location/Qualifiers
FT   CDS_pept        363157..363477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54332"
FT                   /protein_id="ABQ54332.1"
FT                   /translation="MAVLYSLWSNPEADPSEYVIDISIHALTAITLMCKQAPESVKAVA
FT                   MALNTYRGFDALFKAITSLPSTIPGIANAVDVLNHRFNFKELEKLGNEETAETTSAVQH
FT                   TM"
     ttggcagtat tgtatagctt gtggagtaat cctgaggctg atccctctga atacgtcatt        60
     gatatctcta ttcacgcgct gactgctatc actttaatgt gtaaacaagc ccccgaatcg       120
     gttaaagcag ttgccatggc attaaatacg tacaggggat ttgatgcttt attcaaagcc       180
     attacctcac ttccttccac aataccaggc attgccaatg ctgttgatgt attaaatcac       240
     cggtttaatt ttaaggaact tgaaaaactc ggcaatgaag aaactgcaga aaccacatca       300
     gcagttcagc atacaatgta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page