(data stored in ACNUC7421 zone)

EMBL: CP000675.PE334

CP000675.PE334       Location/Qualifiers
FT   CDS_pept        364458..365732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0339"
FT                   /product="MFS transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54334"
FT                   /protein_id="ABQ54334.1"
FT                   /translation="MNSQKDLKQLDIKQVIAWAFYDFANSSYFVVIFTFVFATYFTSYI
FT                   APNTILGTELWGYTISVSALLIALVSPIVGAIADFSGHHKSWLFVFTYLGVISTGCLWF
FT                   AYPDSHSIPLVLTCILISNFALEVATVFYNSFLANLAPENYLGRISGWAWGCGYLGGLL
FT                   CLILSLFVFVKGELGGLWFGTENFANIRAVTVFVALWISVFSLPLFLVVQQKTGEHLTV
FT                   GTAIRKGLQELWLTIISLPKQRDLFLFLIARIFYIDGLNSILALGGIYVAGNFHLSVSD
FT                   IMVFGIILNITAGLGAGLFAWFDDWIGSKKTILIALACLTLTFCFLLTIHSNTLFWVFA
FT                   PVFGIFVGPVQAASRTFLARLAKPEEMTRMYGFYSFSGKATSFLGPFLVSTTTALADSQ
FT                   RLGMAVLIPFFIIGGGLLLLVHENE"
     atgaatagcc aaaaggattt gaaacaatta gatattaagc aagtgattgc ctgggcattc        60
     tacgattttg ccaattcttc ctattttgta gtgatattta cgtttgtctt tgcaacctat       120
     ttcacaagtt acattgcccc caatactata ctgggaaccg aattgtgggg gtatacgatt       180
     tcggtttctg cgttactcat tgccctggtg agtcctatcg ttggtgcaat agctgatttt       240
     agtgggcatc ataaatcctg gctattcgtt tttacctatt tgggtgttat ttcaacaggt       300
     tgcttgtggt ttgcctatcc tgacagccat tctattccct tggttttaac ttgtattttg       360
     attagcaatt ttgcattgga agtagcaact gtattttata attccttttt ggcaaattta       420
     gccccggaaa attatctggg gcggatttct ggctgggcgt ggggttgtgg ttatctggga       480
     ggattactgt gcctgattct atccttattt gtttttgtga aaggtgaact tggtggatta       540
     tggtttggga cagagaattt tgccaatatt cgtgctgtca ctgtatttgt ggctttgtgg       600
     attagtgtgt tcagtttgcc tttgttttta gtggtgcaac agaaaacagg agagcatttg       660
     acagtaggta ctgcgattag gaaaggtctg caagagttgt ggttaacaat aataagcctg       720
     cctaaacaac gtgatctgtt cttattttta atagccagaa ttttttatat cgatgggttg       780
     aattctatat tggcactagg cggtatttat gtggctggca actttcactt gagtgttagc       840
     gatattatgg tgtttggaat cattttaaat attactgcag gtcttggcgc cggattattc       900
     gcctggtttg atgattggat tggatctaaa aaaactattc taattgcttt agcgtgcctg       960
     acactcactt tttgttttct gttaaccatc cactcaaata cgttattttg ggtttttgca      1020
     ccggtgtttg gtatttttgt tggtcctgtt caggctgcca gtcgtacttt cttggctcgt      1080
     ttggcaaaac ccgaagaaat gacgcgaatg tatggttttt actctttttc tggaaaggca      1140
     accagttttt taggaccttt cctggttagc acaaccactg ctttagctga cagtcagcgt      1200
     ttggggatgg ctgttcttat tccttttttt atcatcggag gcggactatt attattggtt      1260
     catgaaaatg aataa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page