(data stored in ACNUC7421 zone)

EMBL: CP000675.PE337

CP000675.PE337       Location/Qualifiers
FT   CDS_pept        368334..368768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54337"
FT                   /protein_id="ABQ54337.1"
FT                   /translation="MKRIFLISIIGIVLNSAYAFEHLGECGAHTWHEVTSKSGSWKITL
FT                   KMISQNGQFVDPSCAEIIETGLAQNNPLSYGLKFSKDADFNLAYTLTAVSEEQGFQSKA
FT                   CVFVITANGPAQPDIQALSYHGAECTWRVIKGIGENFSVG"
     atgaaaagga tttttttaat atcgataatt gggatagttt tgaattctgc gtacgctttt        60
     gagcatcttg gagaatgtgg ggctcatacc tggcatgaag tgacatccaa atcgggttcc       120
     tggaaaatca ctttaaaaat gatcagtcag aatggccagt ttgttgatcc ttcgtgtgca       180
     gaaattattg aaacaggatt ggctcagaat aaccctttga gctatggcct taaattcagc       240
     aaagacgctg attttaatct ggcgtatact ttaacggctg tgagtgaaga acagggtttt       300
     caatcaaaag cctgtgtatt tgttatcact gctaatggtc cagcgcaacc ggatattcag       360
     gcgcttagct atcatggggc tgaatgcaca tggcgggtaa tcaaagggat tggggaaaat       420
     tttagtgtcg ggtag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page