(data stored in ACNUC7421 zone)

EMBL: CP000675.PE340

CP000675.PE340       Location/Qualifiers
FT   CDS_pept        370773..372272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54340"
FT                   /protein_id="ABQ54340.1"
FT                   /translation="MYDDLWKPYASAELPSLKLGGIVLNGQLLSETPIHLVLKAFNRHG
FT                   LIAGATGTGKTKTMQVLAEQLSLNGVPSLVMDIKGDISGLAMPGETSTKLQDRGQQLHI
FT                   DFTPRGFPVELLTLTPQDPGVPLRARIDDFGPLLFSLMLDLNDTQAGVVTVLFEYAKAN
FT                   QLNLVNLDDFKSLLQFAQTDRGNQLIAAQYGGVASTSIGTIVRKIIELESQGGKQFFGE
FT                   PSFVIQDLLRTDANGYGVISILRLLNMQDKPKLFSSFMLKLLSDVYRQMPELGDPDKPR
FT                   LVLFIDEAHLIFNYSSKALLNLIETIVKLIRSKGIGLIFCTQTPNDIPEAVLSQLGLKI
FT                   QHSLRAFTAKDRKALKLVSQNFPVSSYYNTEQLLTTLSIGEALVSALDAKGQPTPLVHA
FT                   MIRAPESRMGPLSNEELKVLLDQSFLFGKYSQIIDTPSAKEKLAELISEQQVAKQQTSQ
FT                   KENNSSVLNSLSKNTLFRQVVRQVFRELTRAILSLFKSKRN"
     atgtatgatg atctatggaa gccttatgcg tctgccgaac taccttcttt aaaattgggc        60
     ggcattgtct taaatggtca gttactctct gaaacgccga ttcacttagt gttaaaggct       120
     ttcaatcgac atggtttaat tgcgggagca accggaacag gtaaaacaaa aaccatgcag       180
     gtattagctg agcaattatc cctaaatgga gtgcccagtt tagtgatgga catcaagggg       240
     gatatttctg gcctggctat gccaggtgaa acttctacca aattacagga cagaggtcag       300
     cagctgcata ttgattttac tccccgaggt ttcccggtag agttattgac actgactcca       360
     caagaccccg gtgttccatt acgtgcgaga attgatgatt ttggtcccct gcttttttcg       420
     ctgatgctgg atctgaatga tactcaggca ggagttgtga ctgtattatt tgagtatgcc       480
     aaggcgaatc aactgaattt ggttaatttg gatgatttta aatctttgct ccaatttgct       540
     caaacggata gaggcaacca gctgattgcc gcccaatatg gcggagttgc ttccacatcc       600
     attgggacta ttgtccgtaa aatcatcgag ctcgagtctc agggtgggaa acagtttttt       660
     ggtgaacctt cctttgtcat tcaggatttg ctgagaacgg atgcaaatgg ttatggtgtc       720
     atttccatac taagattatt aaacatgcag gacaaaccta aactattttc cagttttatg       780
     ctgaagttat tgtctgatgt ttatcgccaa atgccggaat taggtgatcc ggacaaacca       840
     cgattggttc tctttatcga tgaggcgcat ttaattttta attattccag caaagcatta       900
     cttaatttaa tagaaacaat agttaagcta attcgatcca aaggaatcgg gttgatattt       960
     tgcactcaaa cgcctaacga tatccctgag gctgttttaa gccaattggg gttaaaaatc      1020
     caacactcat tacgtgcttt tactgcaaaa gatcgaaaag ccttaaagtt ggtatcgcag      1080
     aattttccag tatccagtta ctataatact gagcaactac tcactacttt aagtataggg      1140
     gaagctttag tgagtgcctt ggatgccaag ggtcaaccga cacctttagt tcatgcgatg      1200
     attagagcac ctgaatcacg tatggggcct ttaagcaatg aggagttaaa ggttttactg      1260
     gatcaatcgt tcctttttgg caaatattct caaataatag acacgccttc tgcgaaagag      1320
     aaattggctg agctaatctc tgagcaacaa gttgcaaaac aacagaccag tcagaaagaa      1380
     aacaattcct cggtgttgaa tagtttaagt aaaaatacct tattccgaca agtggtacgt      1440
     caagttttta gggaactcac cagagcgatt ttgtctttgt tcaagagtaa acggaactag      1500
//

If you have problems or comments...

PBIL Back to PBIL home page