(data stored in ACNUC7421 zone)

EMBL: CP000675.PE346

CP000675.PE346       Location/Qualifiers
FT   CDS_pept        377462..378172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54346"
FT                   /protein_id="ABQ54346.1"
FT                   /translation="MHKKYNYYSLEKEKKTFWQHILDILKAPFRLPGWVVSFFLARNIT
FT                   HVALNPNNIPQQRLIHLTKTSNRPEDDIVVINFKKRPPHKWFNDTLIKIANTIAALPFV
FT                   TPRLRTRLHYDNENDINHVNKLLAEIDALVQGKSKQKYCKGRAFDWSKIHLKGLEFLDP
FT                   KMRGYVYEQLHEKYGYVSYTTKREPNIEFFTLKTPDGSELDSVQVTGEDEEKKPMRERK
FT                   FIITCIARDQNFIN"
     atgcataaaa aatacaacta ctacagtctt gaaaaagaaa aaaaaacatt ctggcaacat        60
     atactggata ttctgaaggc cccatttagg ctacctggtt gggtcgtttc ttttttcttg       120
     gcacgaaata ttactcatgt ggcattaaat cctaataata ttccgcaaca acgtttaata       180
     catcttacta aaacaagcaa tcgtccagag gatgatattg ttgtcattaa tttcaaaaaa       240
     cggccgcctc acaaatggtt taatgacacg ctgattaaaa tagccaatac gattgcggct       300
     cttccttttg taacaccaag attacgtaca agattacatt acgataatga gaatgacatc       360
     aatcatgtga acaagttgct tgccgagatc gatgcgcttg ttcagggcaa atcaaaacaa       420
     aagtattgca aaggcagggc attcgattgg tcaaaaattc atctgaaggg attggagttc       480
     ctggacccta aaatgagagg gtatgtttat gaacaactgc atgaaaaata tggttatgtc       540
     tcatatacaa caaaacgcga acctaatatt gaatttttca ccttaaaaac tcctgatgga       600
     tctgaattgg attcagtgca agttacaggt gaagatgaag aaaaaaaacc aatgagggag       660
     cgcaagttta ttattacctg tattgcgcgg gatcaaaatt tcattaattg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page