(data stored in ACNUC7421 zone)

EMBL: CP000675.PE348

CP000675.PE348       Location/Qualifiers
FT   CDS_pept        380892..382445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54348"
FT                   /protein_id="ABQ54348.1"
FT                   /translation="MIGMRAEQCNLKSFFVHSLKNKSNLLPLIACFNNREINMPKILDS
FT                   NAYREMENELNNLFEQIYKHGKNDRTAITLQVQQFLDNLSESIRDHSRLLLTNIAREEL
FT                   IYFKEKKPGDSREKFQNIDKMSDYFNNLSALINFSVMQQEDPTLRVFYYDMYIQLMNFC
FT                   YLKGDLFGAGAIYTGLIANNLPNSIDRKQLSSESRLIFKDCEEKFKRLFNLSTTYNEHT
FT                   NLKRQFKTALIPALPSLLTVQIYTKDAYDNSVSDFERVQEKLRQLDIEHNRFLNQLQND
FT                   HSTWSKAYYDYMSNVYLPQSIFEYTTLLREYEELITTHGGPIAKQFHEDKNSEHLVSFV
FT                   ESTLLENQSDLKLSPFQNERIVEMLSEIDVVKSECSSPDVFDDISWKLREMNCTLVKAK
FT                   SIGDYTSKIFANLDTPYMEENTDEDPKPVLVEELQTDDVYQLHHSGMKLIRELEQAIED
FT                   HKPKVIYHCSGEANYGFFKEARRRGRHLSPEPMDIEVMDVDVMDYDENDLRNQTVMITV
FT                   "
     gtgattggaa tgcgtgctga acaatgcaac ttaaaatcat tttttgtcca cagtttgaaa        60
     aataaaagta atttattgcc attaattgca tgttttaata atagagaaat caatatgcct       120
     aaaattttag atagcaatgc atatcgcgag atggaaaatg agctcaataa tcttttcgag       180
     caaatttata agcatggtaa aaatgacaga accgcgatta cattacaagt tcagcaattt       240
     ttagataatt tgagcgaatc cattagggat cattcccgct tattgcttac caatattgcc       300
     agagaagaac tcatttattt taaggaaaag aaacctggag attcgcgaga gaaatttcaa       360
     aatatcgata agatgagtga ttactttaac aatttatctg cattgattaa tttctctgta       420
     atgcaacaag aagatcctac tctgcgggtt ttttattatg atatgtatat tcaactaatg       480
     aatttttgct atcttaaagg ggatttgttt ggagcgggtg caatttatac gggtttaata       540
     gctaataacc tccctaactc tattgatcgg aagcaattga gctccgagag tcgcctgatt       600
     tttaaagatt gtgaagaaaa atttaagcga ttattcaatc tctcaactac atacaatgaa       660
     cacactaatt taaaaagaca attcaaaact gctttgatac ccgcattacc gtcacttctc       720
     acggttcaga tatatactaa agacgcttac gataactctg tcagcgattt tgaaagagtt       780
     caggagaagt tacgtcagtt ggatatagaa cataatcggt ttcttaatca attacaaaat       840
     gaccattcaa cctggtctaa agcttattat gattatatga gtaatgttta tctcccgcaa       900
     agtatattcg aatacacgac tcttttaaga gagtatgaag aacttatcac aacgcatggt       960
     ggccctattg cgaaacagtt tcatgaggat aagaattcag aacatctggt aagctttgtt      1020
     gaatcgacgc tattagaaaa tcaatcagat ctcaaattat ctccttttca aaatgagaga      1080
     attgttgaaa tgctttccga gattgacgtg gtaaaaagtg agtgctcaag cccagatgtg      1140
     tttgatgaca tctcctggaa gttgagagaa atgaattgta ctttggtaaa agccaaatct      1200
     attggtgatt atacttccaa aatttttgca aatcttgata ctccatacat ggaagaaaat      1260
     acggatgaag atccgaaacc agtgcttgta gaagaactgc aaacggatga tgtgtaccaa      1320
     cttcaccata gtggtatgaa attgatacgt gagctcgaac aggctataga agatcataaa      1380
     ccgaaggtta tttatcattg ttcaggtgag gcaaactatg gtttctttaa ggaagccaga      1440
     aggaggggga ggcatttgag tccagaacca atggatatcg aagtcatgga tgtggatgtg      1500
     atggattatg atgagaacga tttacgtaat caaaccgtta tgattacggt gtag            1554
//

If you have problems or comments...

PBIL Back to PBIL home page