(data stored in ACNUC7421 zone)

EMBL: CP000675.PE349

CP000675.PE349       Location/Qualifiers
FT   CDS_pept        complement(382511..384736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0354"
FT                   /product="sensory box protein, GGDEF family protein, LssE"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54349"
FT                   /protein_id="ABQ54349.1"
FT                   /translation="MSTESFRILVIDDNPAIHQDFMKILNVSKNSALLNKFDAELFDDE
FT                   TEQLGISLPEFEIDVATQGIEGIEKVKRSLEEGRPYPLAFVDIRMPPGIDGVETIKRIW
FT                   AIDPQIQIVICSAYSDYSWESTVNTLGLSDNLLVLKKPFDVIAVRQLASALTQKWVLAR
FT                   ETQKHTEFLNQLVEERTESLQQSFSLLRATIESSSDGILVVDLQGKIVDYNSQFVKLWN
FT                   IPESIIKKETSEPQLIQYMSTQLLNSEQHAQHVKEFSIHIDDSSMQIYHFRNGKVVECC
FT                   SKPHRVGLQTVGRVWSFRDITEQTRLKEKLEYQATHDALTNLPNRLLLIDRIEHAISGY
FT                   ARHKMKFAILFFDLDRFKMINDSLSHEAGDQLLCAVAERLRSLVRKEDTLARLGGDEFV
FT                   MLFQSFNSEEQIAGVAQKILKSFQKPFHIAERDINIHVSIGISVYPTDGKTVNTLLSNA
FT                   DMAMYQAKFRGGNQFSFYTEKLNKKTNQQFQLELDLQKAIVHHEFFLLYQPQFTVNTHE
FT                   IRSMEALIRWNHPQKGIILPLDFIPTAESSGLIVPIGEWVLRETCKQIGAWRTMGLPEI
FT                   RVACNVASKQLRQRDFPAMVEDLLKEYSVEPHCLELEITENVIIDKEIQRTIKKLKSLG
FT                   VLIILDDFGTGNSSLNLLKQVAVDSLKIDQSFIQNISKSPGDEAIIDAIIAIAQSMNFN
FT                   IIAEGVETQNQLKFLKKRRCNDIQGFLMSKPIPPEEIEKLLQGNRTK"
     atgagtactg aatcttttcg cattctggtc attgatgaca acccggcaat ccatcaggat        60
     tttatgaaaa tcttaaatgt cagcaagaac tctgctttac taaataaatt tgatgccgag       120
     ctgtttgatg atgagacaga acaacttggc atttctttgc ctgaatttga aatcgatgta       180
     gcgactcaag gcattgaggg catagaaaaa gtgaaacgtt cacttgaaga aggacggcca       240
     tacccactcg cctttgttga cataagaatg cccccgggga tagatggggt agaaaccatc       300
     aagcgcattt gggccattga cccgcaaata cagattgtaa tatgcagtgc ctattccgat       360
     tactcatggg aaagcacagt gaataccctg ggtttaagtg ataatttatt ggtgctaaaa       420
     aaaccctttg atgtgattgc cgtaagacag ttggcaagtg ctttgacaca aaaatgggta       480
     cttgccaggg aaactcaaaa acacactgaa tttttaaatc aattggtaga agaacgaacc       540
     gaatctttgc agcaatcctt ctccttattg agagcaacga ttgagtcctc ttcggatggc       600
     attctggttg tcgatttaca aggaaaaatc gttgattaca actctcaatt cgtcaaatta       660
     tggaatatac ccgaatccat cataaaaaaa gaaaccagtg agccccaact cattcagtat       720
     atgtcaactc aattactcaa ttcagaacag catgcccaac atgttaaaga attttctatt       780
     cacatcgatg attccagcat gcaaatttat cattttagaa atggtaaagt ggttgaatgc       840
     tgttccaaac cgcatcgcgt tggtctgcaa acggtaggcc gtgtatggag cttcagagac       900
     atcactgaac aaacgcgatt aaaggaaaaa ctggagtatc aagccactca tgacgcatta       960
     accaatttac ccaatcgctt gttattaatt gatcgtattg aacatgctat cagtggctat      1020
     gcccgccata aaatgaaatt tgccatatta ttttttgact tggaccgctt taaaatgatc      1080
     aatgacagct tgagccatga agcaggcgat caattactgt gtgccgttgc tgaacgatta      1140
     cgatctttgg tgcgaaaaga agatactctc gccagacttg gtggggatga gtttgtaatg      1200
     ctttttcaat cgtttaattc tgaagagcaa attgccggag tagctcaaaa aatcctcaaa      1260
     tcctttcaaa aaccatttca tattgctgaa agagacatca atattcatgt cagcataggt      1320
     attagcgttt atccaacgga tggcaaaaca gtaaacactt tactcagtaa tgcggatatg      1380
     gcgatgtatc aggcaaaatt tcgaggtggt aaccaattct cattttatac agagaaactc      1440
     aacaaaaaaa caaaccagca atttcagctg gaattagact tgcaaaaagc gattgtccat      1500
     catgagtttt tcctccttta ccagcctcaa tttacagtta atactcatga gattcgttcc      1560
     atggaagcat taatccggtg gaatcacccg caaaaaggta ttattttacc cttggatttt      1620
     attcctactg ccgaaagttc agggcttatc gtaccgatag gagagtgggt tttgcgggaa      1680
     acctgtaagc aaattggtgc gtggcgcaca atggggctgc ctgaaattcg tgtcgcttgt      1740
     aatgtagcaa gtaaacagtt aagacaacgc gacttccctg caatggtgga ggatctttta      1800
     aaagaatatt cagtcgaacc tcattgtctg gagctggaaa ttactgaaaa tgtgattatt      1860
     gataaagaaa tacaaagaac gatcaaaaaa ttgaaatcac tcggtgtgtt gattattttg      1920
     gatgattttg gcacaggaaa ttccagcctg aatttattaa agcaggtcgc tgttgatagc      1980
     ctaaaaatag accaatcatt cattcagaat atttcaaaat cgccaggaga tgaagcgatc      2040
     atcgatgcga ttattgctat cgcacaaagc atgaatttta atatcatcgc cgaaggagtc      2100
     gaaacgcaga accagcttaa attcctcaag aaaaggcggt gtaatgacat tcaaggcttt      2160
     ttaatgagta agcctatacc accagaagag atagaaaaac ttctgcaagg aaataggaca      2220
     aaataa                                                                 2226
//

If you have problems or comments...

PBIL Back to PBIL home page