(data stored in ACNUC7421 zone)

EMBL: CP000675.PE354

CP000675.PE354       Location/Qualifiers
FT   CDS_pept        complement(389870..390646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54354"
FT                   /protein_id="ABQ54354.1"
FT                   /translation="MSEREWPANDYAIGSYIQATVAEKYLAYLKVNPTDKILDIGCGNG
FT                   AFTKNILLQVPQGSVLGIDASENMLHLAQDMSKKFPNFSVQKADVLTMTFNSQFDYVVS
FT                   FWCLQWACANIQKAFFNIINALKTGGKFLTLFPAGDDPFIMSYYALRKSGQFASLHNFI
FT                   PPVDYSHLNNLEKKLESLTCRDLNVKLCRQSITLPSLDTFRKFVNGIAFYQGQLPNEEI
FT                   KQINEAMVRYYDSECQTKYHGEYQFNFTIYLVTGEK"
     atgtcagaac gtgagtggcc cgccaatgac tatgccattg gatcttatat tcaagcgact        60
     gtggctgaaa aatatttagc gtacctgaaa gtaaatccca ctgataaaat attggatatt       120
     ggatgcggta acggcgcttt tacaaaaaac attcttctgc aagtgcctca aggctctgta       180
     ttaggcatag acgcttcaga gaatatgcta catttagccc aagacatgag taaaaaattc       240
     cctaattttt cagtccaaaa agcggatgta ctcactatga cattcaactc acagtttgat       300
     tatgtcgtct ctttttggtg cttgcaatgg gcatgcgcca atattcaaaa agcatttttt       360
     aatatcatta acgcattgaa aaccggagga aaatttctca ctctttttcc agcaggagac       420
     gacccgttta tcatgagtta ttatgcttta agaaaatcag gacaatttgc atccttgcat       480
     aattttatcc ctcccgtgga ttattctcac ttaaacaacc tcgaaaaaaa actggagtca       540
     ctcacctgcc gtgatcttaa tgtgaaacta tgccgacaat ccattaccct gccatccctg       600
     gatactttca ggaaatttgt caatggcatt gctttttatc aaggacaatt gcccaatgaa       660
     gagataaagc aaatcaacga agcgatggtt cgttattacg atagcgaatg ccaaacaaag       720
     tatcatggtg aatatcaatt caatttcact atctatctgg taactggcga aaaataa          777
//

If you have problems or comments...

PBIL Back to PBIL home page