(data stored in ACNUC7421 zone)

EMBL: CP000675.PE356

CP000675.PE356       Location/Qualifiers
FT   CDS_pept        complement(392171..393295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54356"
FT                   /protein_id="ABQ54356.1"
FT                   /translation="MFTKSCAKATDQNRQELLMDSLLGDFQKMKEKALNQQQEKRSKKR
FT                   EFNSLSSEKTKKPNQYAALTHSQVQEVKAKARTVNDKFHLNAEEKKLWELILLGNQLAQ
FT                   NISSCDLPTDNEDDASLVKLTQIFADETLERTDLTWLNKILKIALYSRGSGFGNCQEKA
FT                   FFAFALLLHQAQKPESLIHSLRLATFNNHFILIVNEQFLMDPWLNLAFPLSKGNQQLEI
FT                   GYVFEGFGRLVNYFSINQEGQCFTHAVREGDTTERDLSSEKDMANCIHSLLDHRDYFDL
FT                   SIVSEREIHTKTKRRKYETQEQEVPQPRQETSNQPKETVYTDSNHNTWDNEGAADDFLE
FT                   HFEQTHPVYNPGFFSFGQDDVGFKPDLPKNLFKF"
     atgttcacaa aatcctgtgc caaagcgact gatcaaaata gacaggaatt acttatggac        60
     agccttttag gtgattttca aaaaatgaaa gaaaaagcac ttaatcagca acaagaaaaa       120
     cgctccaaaa aaagagagtt taatagctta tcttctgaaa aaacaaaaaa accgaatcag       180
     tatgctgccc ttactcattc tcaagttcag gaagttaagg caaaagcccg cacagttaat       240
     gataaattcc atctcaatgc tgaagaaaag aaactatggg aactgattct gcttggcaat       300
     caattggcac aaaacatcag ttcctgtgat ttacccaccg ataatgaaga cgatgcttca       360
     ctggttaagc taactcaaat tttcgctgat gaaactctgg aaagaactga tttgacctgg       420
     ctaaataaaa ttctgaagat tgctctgtat agcagaggtt ccggttttgg taattgtcag       480
     gaaaaagctt tttttgcttt tgcacttctg ttacaccagg cacaaaaacc agaaagctta       540
     attcactccc ttcgattagc gacctttaat aaccatttta tattaatagt caatgaacag       600
     tttttaatgg atccctggtt gaatttggcc ttccccttat caaagggtaa tcaacaactg       660
     gaaataggtt acgtttttga gggattcggc cgacttgtca attatttttc aatcaatcag       720
     gaaggtcaat gttttaccca tgcagtgcga gaaggagaca ctacagagcg tgacctatca       780
     tctgaaaaag acatggcaaa ctgtattcat tcgctacttg atcacaggga ttattttgat       840
     ctatcaatcg tttcggagag agaaattcat accaaaacaa aaagaagaaa atatgagact       900
     caggaacaag aagtgcctca acctagacaa gaaacatcca atcagcctaa agaaacagta       960
     tatacagact caaaccataa cacttgggat aacgaaggag ccgcagacga ttttctagag      1020
     cattttgagc aaacacaccc tgtctacaat ccaggtttct tttcatttgg ccaagacgat      1080
     gttggtttca aaccagacct tccaaagaat ttatttaaat tttaa                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page