(data stored in ACNUC7421 zone)

EMBL: CP000675.PE357

CP000675.PE357       Location/Qualifiers
FT   CDS_pept        393552..394214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54357"
FT                   /protein_id="ABQ54357.1"
FT                   /translation="MSKEQIKKTALEIVEYIHGNIKACNIPNQKRENKFFAPLVYLCQT
FT                   ECDKILSNTKISLLERLLKCAKIVDDLQSGNCMQQAFLAFQRLLTRLIEDKLSNFSTCI
FT                   PISIMTISKHAFLIIDNDIVCDPWLNFVGDLRDYRFAKMKRKEYFGIRSDWTCFTNTEV
FT                   YDEDSTEFTIQFVNALGVGISGFSEVKLANQLMQSSSMASDLGEDPVISIPKEFHQI"
     atgagcaaag aacaaattaa gaaaacagca ctggagattg tcgaatacat tcatggcaac        60
     ataaaagcgt gtaatatccc caatcaaaaa agagaaaata agttttttgc gcctttggtt       120
     tatctctgtc aaacagaatg cgataagatt ttgagtaaca ccaaaatcag tttattggag       180
     cgtcttttaa aatgcgcaaa aattgtcgat gatctgcaat caggaaattg tatgcagcaa       240
     gcttttttag catttcaacg tttattgacg cgattgattg aggataagct atctaatttt       300
     tccacgtgca ttccaatttc gatcatgacc atttccaagc atgccttttt aatcattgat       360
     aacgatattg tgtgtgatcc ctggttaaat tttgtgggag atttgcggga ttatcgcttt       420
     gcaaaaatga aaaggaagga gtattttgga atacgttccg actggacttg ttttaccaat       480
     acagaggtct atgatgaaga ctctactgaa tttacaatcc aatttgtaaa tgctttaggg       540
     gtagggatat cgggtttcag tgaagttaag ttggcaaatc aattgatgca atcatcgagt       600
     atggcttctg atcttggaga ggatcctgtg atttctatcc ccaaagagtt tcatcaaatt       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page