(data stored in ACNUC7421 zone)

EMBL: CP000675.PE358

CP000675.PE358       Location/Qualifiers
FT   CDS_pept        394228..394341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54358"
FT                   /protein_id="ABQ54358.1"
FT                   /translation="MIVMNSIAVVFVQVPVRFNGKYIVLDNDGGEDEFFKQ"
     ttgattgtaa tgaactctat tgctgttgtt tttgttcaag ttccggttcg atttaacggg        60
     aaatatattg tacttgataa tgatggggga gaggatgaat tttttaaaca ataa             114
//

If you have problems or comments...

PBIL Back to PBIL home page