(data stored in ACNUC7421 zone)

EMBL: CP000675.PE362

CP000675.PE362       Location/Qualifiers
FT   CDS_pept        396539..397519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54362"
FT                   /protein_id="ABQ54362.1"
FT                   /translation="MRDTSLSWQKILAQGFTSTADLLDFLELPRSEGNLFAEKQFPSRI
FT                   PLGFAERMQKGNPKDPLLLQVLAKEDELTVADDYVIDPLSESNTLIKGLLHKYHGRVLL
FT                   TLTGVCAVNCRYCFRRHFPYQANNPGRRGWKEVCAYIANDPSITEVILSGGDPLLAANL
FT                   VLEELLQSLEEISHVHTLRIHTRIPIVLPERIDKGLLDLLTNTRFKKVIVVHCNHPQEL
FT                   DESVLRACSDLKKATCYLLNQSVLLAGVNDDAVILSKLSHALFDYGIMPYYLHLLDKVK
FT                   GSAHFDMPLPRAQSIYHQLQSLVPGYLLPRLAREEPGRSSKTLLI"
     atgcgagata cctctttgag ttggcaaaaa attttggcac aaggatttac ttcaacggct        60
     gatttattag atttcctgga gttgccgaga tctgaaggaa acctattcgc ggaaaaacaa       120
     ttcccaagcc gcattccttt aggttttgct gagcgaatgc aaaaagggaa tcccaaagat       180
     cccttgcttt tacaggttct tgcaaaagaa gatgagctta ccgtagcaga tgattatgtt       240
     atcgatcctc tgagtgaaag taataccctt attaaaggtt tgttgcataa atatcacgga       300
     cgtgttttgt taactttaac cggtgtttgc gctgtgaatt gtcgttattg ctttagaaga       360
     cattttcctt atcaagcgaa taatccgggc cgccggggat ggaaagaggt gtgtgcctac       420
     atcgcaaatg atcccagtat tactgaagtt attttaagtg gtggcgatcc attgctcgct       480
     gccaatttgg ttttggaaga attactccaa tctttggaag aaatttctca tgtacatact       540
     ttaagaattc atacaagaat tcctattgtt ttaccggagc gtattgacaa aggattactt       600
     gatttattaa caaatacgcg atttaagaaa gtgattgttg ttcattgtaa tcatccgcaa       660
     gagttggatg agagtgtatt gcgggcgtgc tctgatttga agaaagcgac atgttattta       720
     ctgaatcaat ctgttttatt agcaggggtt aatgatgatg cagtgatttt atccaagcta       780
     agtcatgctc tttttgatta cgggatcatg ccttactact tgcatttgct cgataaagta       840
     aagggttcgg cacatttcga tatgccgctt cctagggctc agtcaattta tcatcaatta       900
     cagtcccttg tgccagggta tttattgcct cgcttggcac gagaagagcc gggaagatcc       960
     agtaaaacct tactgattta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page