(data stored in ACNUC7421 zone)

EMBL: CP000675.PE365

CP000675.PE365       Location/Qualifiers
FT   CDS_pept        complement(400982..401515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0370"
FT                   /product="chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54365"
FT                   /protein_id="ABQ54365.1"
FT                   /translation="MIKTFIEIIYSFGKIGLISLGGGNSMLKLLEYEAVTYRHWIGKEE
FT                   FVGMLGSSFLFPGLTGIKLAALIGYKAAGITGLILAIICLNLPGLIMALVGYQWLNSHN
FT                   GPITRKIMISVQYGALALLAAATFSVVQGVIDVYYSIPMAICCILFFLALAFWNLSPFY
FT                   GFLAFIAVCFFVVR"
     atgataaaaa ctttcattga aatcatttac agtttcggga aaattggcct gatatcctta        60
     ggcggcggca attccatgtt aaaattattg gaatatgagg cagtcacgta caggcactgg       120
     ataggaaaag aagaatttgt aggtatgtta ggttcaagtt ttttattccc gggattaacg       180
     ggaataaaac tggccgcact aataggctat aaagcggccg gaataaccgg tttaattctt       240
     gcgatcatct gcctgaattt accaggatta attatggctc ttgtgggata tcagtggctt       300
     aattctcata acggtccaat aacacgcaaa attatgatct cagtccaata cggagctttg       360
     gccttgttag cggctgctac attttcagta gttcaaggtg ttatcgacgt ctattactct       420
     attcctatgg ctatttgctg tattttgttt tttcttgcct tggccttttg gaatctatca       480
     cccttttatg gttttttagc atttatagcc gtatgttttt ttgtggtgcg ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page