(data stored in ACNUC7421 zone)

EMBL: CP000675.PE366

CP000675.PE366       Location/Qualifiers
FT   CDS_pept        complement(401512..402132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0371"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54366"
FT                   /protein_id="ABQ54366.1"
FT                   /translation="MQRLVWNFEFSSEQTTPLTTLDHDAQDNLKWEKRYFWPADQIIRL
FT                   NTIDSSLLDLANYQKKHKEDYYYLLPDSDHNIKQRRNELLYKPVIKQSGSALGFGPKVH
FT                   LENPQTLSCHGDAGQLNRQELLKKIKEKGIVVFVKKEAFVFKFPTTPTVKLELARLEVK
FT                   DKVYFSACIEGRSLKLVETISVLLFGTQPSFEYVTFLKKTLKI"
     atgcaaagac tggtttggaa ctttgaattt tcctctgaac aaacaacacc acttaccact        60
     ttagatcatg atgctcaaga caatctaaaa tgggaaaagc gctatttttg gcctgcagat       120
     caaatcatcc gtttaaatac tattgacagt tcgttgcttg atctagccaa ctatcagaaa       180
     aaacataaag aagactatta ttatttactg cctgactctg atcataatat aaagcaaagg       240
     cgtaatgaat tattgtataa acctgttatt aagcaatctg gctctgcact aggttttgga       300
     cctaaagttc atcttgaaaa cccacaaacg ctctcttgcc atggcgatgc tgggcagtta       360
     aatcgacaag aactattgaa aaaaataaaa gaaaaaggaa tcgttgtttt tgttaaaaaa       420
     gaagcctttg tttttaaatt ccctacaacg ccaactgtca agcttgagct tgctcgtctt       480
     gaagtcaagg ataaagtgta tttcagtgcc tgtattgagg ggagatcatt aaaactggta       540
     gaaaccatca gcgtcctttt attcggaacc caaccttctt ttgaatacgt taccttctta       600
     aaaaagactt taaaaatatg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page