(data stored in ACNUC7421 zone)

EMBL: CP000675.PE368

CP000675.PE368       Location/Qualifiers
FT   CDS_pept        404860..405552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54368"
FT                   /protein_id="ABQ54368.1"
FT                   /translation="MPKYTLPTRDALLKAMQVGETSIEAAEYMATRFEQILTQAKLLPE
FT                   CNDMLEKIQEYAQFVKFKLLSSAQVWSGQERPISDYQNMQENKAEFLASHLKELPSGLK
FT                   LEIAIGDDAKILRGFSSNGKMVEGEQLKTMDGLLEGWLAKNNLAISGGAVVQRNSTGNQ
FT                   TSVDPEEIRKLINDSEKGVAKYFADKGVSMEVVQRTYQEPKALETKREEIRQEIESGAE
FT                   APTTQSIR"
     atgccaaaat acacactgcc cacaagagat gccttattaa aagcaatgca agtaggtgaa        60
     acatccattg aagccgctga atatatggca acaaggtttg agcagatttt aacgcaagcg       120
     aagttattac cagaatgtaa tgatatgctg gaaaaaatac aggaatatgc tcaatttgtt       180
     aaattcaaat tattatcctc tgctcaagtt tggtctggcc aagaaagacc aatttcggat       240
     taccaaaata tgcaggaaaa taaagctgaa tttttggcaa gtcatttgaa agagttgcca       300
     agtggattaa aactcgaaat tgctattggg gacgatgcca aaatattgcg aggattttct       360
     tccaatggaa aaatggtaga aggagaacag ctgaaaacca tggatggatt attagaagga       420
     tggcttgcca agaataatct tgctatttca ggaggtgctg ttgttcaaag aaacagtact       480
     ggcaaccaaa ctagcgtaga cccagaggaa atcagaaaat taataaacga tagtgaaaag       540
     ggagtcgcca aatattttgc agataaaggc gtgagcatgg aggtggtaca acgaacctac       600
     caagagccca aagcattgga aaccaagcga gaagaaatca ggcaagaaat tgaatccggt       660
     gctgaagccc caaccactca atccatcaga tag                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page