(data stored in ACNUC7421 zone)

EMBL: CP000675.PE37

CP000675.PE37        Location/Qualifiers
FT   CDS_pept        complement(43005..43727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54037"
FT                   /protein_id="ABQ54037.1"
FT                   /translation="MNYQYSPSLKKKLLLAFTTLFIVQMFYFAPVRASTRDTQLWTLMN
FT                   AIGPINKQHRKIRYWLEIQDRIGENISQLSQLILRPGIGYELLPTTTIWLGYDRIYTAQ
FT                   PFANPPVNENRVWQQLLWSKEYTRLRLTARSRLEERFIQRAIHTAWRYRQLFKTSIFIP
FT                   KHPKYAAVISDEAFFHLNDFNLQRNQGFDQNRLFVGLGYRTSKNSTIEIGYLNQMIKRV
FT                   NNPDYRGDYLSMALLLTE"
     atgaattatc aatattcccc cagcctaaag aaaaaactcc tgctcgcatt tactacttta        60
     tttattgtac aaatgttcta ttttgcccct gtcagagcat caacaaggga tactcaatta       120
     tggacactta tgaatgcgat aggaccaatc aataagcagc atcgcaaaat aagatattgg       180
     cttgagatac aagacagaat tggtgaaaat atttcgcaat tgtcccaact gatattacgc       240
     cctggcatag gatatgaact cttgcctaca acaaccatct ggctcggata tgatagaatt       300
     tatactgcgc aaccatttgc caaccctcct gtaaacgaaa atcgagtttg gcaacaatta       360
     ttgtggagca aggaatatac tcgcttaaga cttactgctc gttcacgttt ggaagagcgc       420
     tttatccaaa gagccattca taccgcctgg cggtatagac aattatttaa aaccagtatt       480
     tttattccca aacaccctaa atacgcagcc gtgattagtg atgaagcttt ttttcatctg       540
     aatgacttca accttcaacg taatcaaggc tttgatcaaa accgtttatt tgttggctta       600
     ggttatagaa ccagtaaaaa cagcactata gagattgggt atctcaatca aatgattaaa       660
     cgcgtaaata accctgacta tcgcggagat tatttatcca tggctctatt attaacagaa       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page