(data stored in ACNUC7421 zone)

EMBL: CP000675.PE375

CP000675.PE375       Location/Qualifiers
FT   CDS_pept        complement(412923..413468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54375"
FT                   /protein_id="ABQ54375.1"
FT                   /translation="MSKLVYLLLMIFFLNPAWANTHYHQHPVSPLANALRTGTDTNGNA
FT                   LYLCKAKLFNSIQPGKTWAGYGRCNVPYGGKEYVLSQFTIPNQNEFGRYSWEPNVEHAL
FT                   LMGKDTNGNPLFVCQSNFNGSIQPGKTWPGYSHCNISYGGREIITDNYRILSRPTEIIV
FT                   RTQPPVHRHPSQNRHYHY"
     atgtccaaac ttgtatacct tttattgatg atattctttc ttaatcctgc ctgggctaat        60
     actcattacc atcaacatcc tgtttcaccg ttagctaatg cgttacgaac tggaactgac       120
     acgaatggca atgcattgta tctgtgtaag gcaaaactgt ttaacagtat acagcctgga       180
     aaaacatggg caggatatgg tcgatgcaac gtaccttatg gtggtaaaga atacgttctt       240
     agccagttta ccataccgaa tcaaaatgaa tttgggcgat acagctggga acccaacgta       300
     gagcatgcat tgttaatggg taaagatacc aatggtaatc ctttatttgt ctgtcaaagt       360
     aacttcaatg gaagtattca gcctgggaaa acatggcctg gttactcaca ttgtaatatt       420
     tcttatggtg gtcgggaaat tataacggac aattatagaa tactgagcag gccaactgaa       480
     ataattgtaa ggactcagcc accagtgcac agacatccct cacaaaacag acattatcat       540
     tattga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page