(data stored in ACNUC7421 zone)

EMBL: CP000675.PE378

CP000675.PE378       Location/Qualifiers
FT   CDS_pept        421716..422150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56925"
FT                   /db_xref="GOA:A5IHS5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS5"
FT                   /protein_id="ABQ56925.1"
FT                   /translation="MAKKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAA
FT                   TQQMEQGLPIPVVITVYSDRSFTFITKTPPASVLLKKAAGIQSGSGTPNTKKVAKLNVS
FT                   QLEEIAKVKKPDLTAADLAAAVRSIAGTARSMGIEVEGLE"
     atggcaaaaa aagtagaagc atatattaaa ttacagatcc ctgcaggaaa ggcaaatcct        60
     agccctccag ttggacctgc tttaggtcaa cgtggggtaa atattatgga attctgtaaa       120
     gcattcaatg ctgcgacaca gcaaatggaa caaggtctgc ctattccagt tgttatcact       180
     gtatatagtg atcgtagttt tacctttata accaagaccc ctccagcttc agttctgctg       240
     aaaaaggctg ctggcattca aagcggaagt ggcacaccaa atactaaaaa agtggccaaa       300
     ctgaatgtta gtcaacttga agaaattgct aaggtcaaga agcctgatct gacagcggct       360
     gatctagcag cggctgtaag aagtattgca ggtacagcac gtagcatggg tattgaagtt       420
     gaaggtttgg aataa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page