(data stored in ACNUC7421 zone)

EMBL: CP000675.PE379

CP000675.PE379       Location/Qualifiers
FT   CDS_pept        422160..422855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56924"
FT                   /db_xref="GOA:A5IHS4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS4"
FT                   /protein_id="ABQ56924.1"
FT                   /translation="MSKLTKKQKKIAEVIKPNQLYTVADAVAILKQFASKKFRESLDIS
FT                   INLGVDPRKSDQVVRSSTNLPKGTGKTVRVAVFAQGDNAAKATAAGADIVGFEDLADKI
FT                   KAGEMNFDVVIATPDAMRIVGQLGQILGPRGLMPNPKVGTVTTNVEAAVNDAKSGQVRY
FT                   RTDKNGIIHCTVGKADFAPEDVLENVVALINDLKKAKPASSKGQYLKKISLSTTMGPGL
FT                   PIDISSIPV"
     atgtcaaaat taactaagaa acaaaagaaa atagcggaag ttattaagcc aaatcaactc        60
     tatacagttg ctgatgctgt agctattcta aagcaatttg catcaaaaaa atttcgtgag       120
     agccttgata tcagtattaa tttaggagtt gatcctcgta aatcggatca agtagtacga       180
     tcttctacca atctgccaaa aggtacagga aaaacagtac gagttgccgt ttttgcccag       240
     ggtgataatg ctgctaaagc tactgctgca ggtgccgata tagtaggatt tgaagatctg       300
     gctgataaaa tcaaagcagg cgaaatgaat tttgatgttg ttattgcaac tccagatgct       360
     atgagaatcg taggtcagct cggacagatt ttgggaccaa ggggactcat gcccaatcct       420
     aaggttggaa cagtaacaac taacgtggaa gcagcagtta atgatgccaa atcaggacaa       480
     gtaagataca gaactgataa aaatggaatt attcattgta ctgttggaaa ggcagatttt       540
     gctcctgaag atgttcttga aaacgtagtt gcattaatca atgatctgaa gaaggcaaag       600
     ccagcatcct ctaaagggca atatctgaag aaaatatctt tatctacaac aatgggacct       660
     gggttaccta ttgatatttc gtcaatacct gtgtaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page