(data stored in ACNUC7421 zone)

EMBL: CP000675.PE380

CP000675.PE380       Location/Qualifiers
FT   CDS_pept        423028..423561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56923"
FT                   /db_xref="GOA:A5IHS3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS3"
FT                   /protein_id="ABQ56923.1"
FT                   /translation="MTLNLAAKKAVVEEVTAVASKAISAVVADYRGLTVNQMTQLRSEA
FT                   RKSGVYLRVVRNTLTRRALKNTEFECLNDLLVGPVFIALSLEAPSDAARLLKDYAKTFE
FT                   KLEIRALSVGGKVYNANQIDAVASLPTRDEAISKLMYVMKAPIEKFVRTLAEPHAKLAR
FT                   TLAAVKDKKAGNPA"
     gtgacattaa atttagctgc aaaaaaagcc gttgttgaag aagtgactgc agtcgcgtca        60
     aaggctattt cagcagtggt tgctgattat cgtgggttaa ctgtaaatca aatgacgcaa       120
     ttgcgtagtg aagcacggaa atccggtgtt tatcttcgtg tggtgcgaaa tacactaaca       180
     agaagagcgt taaaaaacac tgaatttgaa tgcttgaatg acttacttgt aggtccagta       240
     ttcattgcat tgtcactgga agcaccaagt gatgctgcaa ggctactgaa agattacgca       300
     aaaacatttg aaaaacttga gattagagca ttatcagttg gcgggaaggt atacaacgca       360
     aatcaaattg atgctgttgc gagcttgcca acacgcgatg aggcaatatc caagttaatg       420
     tatgtgatga aagcgccaat tgagaaattt gttcgtacac ttgcagagcc acatgccaag       480
     ttggctagaa ctcttgctgc tgtaaaagac aaaaaagcag gcaatcccgc ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page