(data stored in ACNUC7421 zone)

EMBL: CP000675.PE40

CP000675.PE40        Location/Qualifiers
FT   CDS_pept        46626..47108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54040"
FT                   /protein_id="ABQ54040.1"
FT                   /translation="MKFRFRFYLGIILLILAIVCPLLIPLIVQSNFSVLMKGFLSSILV
FT                   FGLPEVLIVLAIALLGKEVYGLIEQKIKNILFKEKVSRARYRLGLVFFAFPLVIGLLEV
FT                   FVKEITLAYGSYYYWVEIIWTTMFALSFFICGKQFWDKFKSLFIYDSYVVFEKNKK"
     ttgaaatttc ggttccgttt ttatctgggt attattcttt taattttggc gatagtttgc        60
     cctttgctga tcccgttaat tgtgcaatcc aatttctctg tgctgatgaa gggatttcta       120
     tcttcaatat tagtatttgg tcttccggaa gttttgattg tcttagctat cgctttactt       180
     ggaaaagaag tgtatggcct tatcgagcaa aaaattaaaa atattctttt taaggaaaaa       240
     gtatcaagag cccgttatcg tctaggtttg gtattctttg cttttccact tgttataggg       300
     ttgctggagg tgtttgtaaa agaaattacc ttagcctatg gaagttatta ttattgggta       360
     gaaattattt ggacaacgat gtttgcttta agctttttta tttgcgggaa acaattttgg       420
     gataaattta aatctttatt tatttatgat tcttatgttg tttttgaaaa aaataaaaaa       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page