(data stored in ACNUC7421 zone)

EMBL: CP000675.PE406

CP000675.PE406       Location/Qualifiers
FT   CDS_pept        444775..445281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2996"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2996"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56897"
FT                   /db_xref="GOA:A5IHP7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP7"
FT                   /protein_id="ABQ56897.1"
FT                   /translation="MSFDELPKSDGYQEKLVSVTRTAKVVKGGRVFGFAVLVVVGDGKG
FT                   KVGFGRGKAREVPIAIQKAMDQAKKNMVYIPLSGTTIFHEITWNYGASKVFMKPASEGT
FT                   GIIAGGAMRAVLEVLGVQNILAKSIGSTNPSNIVRATIGALTHIGTPDYVAAKRGKTVE
FT                   EVMAG"
     atgtcattcg atgaattacc caagtcagat ggataccaag aaaaattggt atcggtaact        60
     cgtacggcta aagttgtaaa gggtggacga gtttttggtt ttgctgtttt agtagttgta       120
     ggtgacggaa agggtaaagt aggttttgga cgaggtaagg caagagaggt tccaatagca       180
     attcaaaaag ctatggacca agccaagaaa aatatggttt acattcctct ttcaggtact       240
     acaatattcc acgaaatcac atggaactat ggagcttcca aggtgtttat gaagccagca       300
     agtgaaggta ctggaattat tgctggaggt gctatgcgtg ccgttttgga agtgttgggt       360
     gtgcaaaata ttcttgcaaa aagcattggt tctaccaatc caagtaacat tgttcgtgcc       420
     actattggtg cattgacaca cattggtacg ccggactatg tagcagccaa acgtggaaaa       480
     acagttgaag aagtaatggc aggctaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page