(data stored in ACNUC7421 zone)

EMBL: CP000675.PE41

CP000675.PE41        Location/Qualifiers
FT   CDS_pept        complement(47130..48125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0041"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54041"
FT                   /protein_id="ABQ54041.1"
FT                   /translation="MDPITHGVLGAACAQAAFGKFDKRIPWQAGALAGMAPDLDVFIRF
FT                   SQEPLSLEQWHRYLTHSLMFIPIGGLVVALFLLCFSQYRQYWKVTIGASLVGYATHCLL
FT                   DSLTSYGTVLFWPWSDSRISWDIISIIDPVFTLPLLLGTAWSVIYQNQKAVTASLFFCI
FT                   LFLIFNTILHNRAVDGIHQYATSNNFKINHPRALPKLASSTDWRIIAKQQDCLIIAEAK
FT                   TSLFYPTTIRLIRKALSFNESMIPFALSSGQKSDLATFHWFTDGFLIVANKNPLILADA
FT                   RYTIDDSPIFSLWGIEILPGQEHINKLSLPKINEYCKSPDSESYNENGLN"
     atggacccta taactcacgg tgttttaggt gctgcttgtg cacaagcggc ttttggaaaa        60
     tttgacaaga gaatcccctg gcaagcaggt gctttagcag ggatggctcc ggatttggat       120
     gtttttattc gttttagcca agagccattg agccttgagc aatggcatcg ttaccttacg       180
     cattccttaa tgtttatccc aattggaggc ctggtagttg cactgtttct attgtgtttt       240
     tcacaatata gacaatattg gaaagtaacc attggagcct ctcttgttgg ttatgcaact       300
     cattgtttat tagattcctt gacttcttac ggtaccgttt tattttggcc ctggagcgat       360
     agtcgtatta gttgggatat tatttctatt attgatcccg tatttacctt acctctattg       420
     ttaggaacag cctggtcagt catctatcaa aatcaaaagg cagtaactgc aagcttgttt       480
     ttctgcattt tatttctgat ttttaatacg atattacata atcgcgctgt agatggcatt       540
     caccaatacg ccacgagtaa taacttcaaa ataaaccatc ctcgtgccct gcctaaattg       600
     gccagctcta ctgattggcg catcatagcc aagcaacaag attgtttaat tatagcggaa       660
     gcgaaaactt cccttttcta tccaaccaca atccgactga ttcgaaaagc tttaagcttt       720
     aatgaatcaa tgattccttt tgctttgtca tccggacaaa aaagtgattt ggctacattt       780
     cactggttta ccgatggatt tctaattgtt gccaataaaa atcccttaat cctcgcagat       840
     gcgagatata cgatagatga cagccccata ttctcactat ggggaataga aatattgccc       900
     gggcaagaac atattaataa attaagcttg cctaaaatca atgaatattg taaatcgcca       960
     gatagcgaaa gctataatga gaacggacta aactag                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page