(data stored in ACNUC7421 zone)

EMBL: CP000675.PE410

CP000675.PE410       Location/Qualifiers
FT   CDS_pept        447822..448220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2992"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2992"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56893"
FT                   /db_xref="GOA:A5IHP3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP3"
FT                   /protein_id="ABQ56893.1"
FT                   /translation="MAITKSKQQKTRKKVKRVVSDGIVHIHASFNNTIVTFTDRQGNAL
FT                   CWATSGGSGFRGSRKSTPYAAQVATERAAAVAKEYGMKSVAVFVHGPGPGRESTIRELI
FT                   TQDFKIVEITDVTGIPHNGCKPPIKRRV"
     atggcaataa caaagtcaaa gcagcaaaaa acacgaaaaa aggtaaagcg cgtagtgtct        60
     gatggcatag tacacattca tgcatctttc aataatacta tagttacctt tacagataga       120
     caaggtaatg cattatgctg ggcaacttct ggtggatctg gcttcagagg ttctagaaaa       180
     agtactcctt atgctgcgca agttgcaact gagcgagctg ctgctgttgc taaagaatat       240
     ggtatgaaat ctgttgcagt ttttgtgcac ggtcctggtc ctggtcgtga atctactatt       300
     cgtgaattaa taacccagga ttttaaaatt gttgaaatta ccgatgtaac tggcatacca       360
     cataatggtt gtaagccacc tataaaacgt cgtgtataa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page