(data stored in ACNUC7421 zone)

EMBL: CP000675.PE422

CP000675.PE422       Location/Qualifiers
FT   CDS_pept        complement(458089..458394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2980"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56881"
FT                   /protein_id="ABQ56881.1"
FT                   /translation="MDERRKYFRLKNHGEINASLDNNPIEIVEISSNGAVVVKQKTDIP
FT                   KEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKNKT"
     atggacgaaa ggcgaaaata ttttcggcta aaaaaccatg gcgaaataaa tgccagctta        60
     gacaataatc caattgagat tgttgaaatc tcttccaatg gtgctgtagt agttaagcag       120
     aaaactgata ttcctaaaga gggagtgctt aaactacaaa tccataactt tattatggaa       180
     ctttgctatg aagtgattcg agctgaagac aacaacattg tccttcattt cacaaaagaa       240
     gatgaaacga ataagttatt tctggtactc aaacgattaa gagacgaacg aaaaaataaa       300
     acttaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page