(data stored in ACNUC7421 zone)

EMBL: CP000675.PE425

CP000675.PE425       Location/Qualifiers
FT   CDS_pept        complement(462713..463075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2977"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56878"
FT                   /protein_id="ABQ56878.1"
FT                   /translation="MSILFLARKLASDYGFIEQIQQSHNRNQINYRFYSPRTDLHGSNT
FT                   NRLYGNPGKGVISQNTIFIYWYRDGKNSYFIECSNRLPKKELEVLHQLLMDNQHSLEEI
FT                   LEASNNRFLSFQTRHT"
     atgagtattt tgtttttagc aagaaaactg gcttctgact acggatttat tgagcaaatc        60
     cagcaaagcc ataatcgtaa ccaaataaat tatcgctttt attccccacg aactgatctg       120
     catggttcca atacaaacag gttatatgga aatcctggca aaggtgtcat ttcacaaaat       180
     acgattttca tatactggta cagagatgga aaaaacagtt attttattga atgttcaaat       240
     agactaccta aaaaggaact tgaagtgttg catcaattgc tcatggataa tcaacactct       300
     ttggaagaga tactcgaggc atccaataat agatttctct cttttcagac acgccatacc       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page