(data stored in ACNUC7421 zone)

EMBL: CP000675.PE427

CP000675.PE427       Location/Qualifiers
FT   CDS_pept        463909..464343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2975"
FT                   /product="oligoketide cyclase/lipid transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2975"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56876"
FT                   /protein_id="ABQ56876.1"
FT                   /translation="MTIVKRSRTVPYSCEQMYGLVNDVEHYSEFLPYCAESKILHRDND
FT                   EVQATLVIAAAGMSKSFTTRNRLQTNKMIEIRLVDGPFSHLEGFWRFDQEEKGCRISFD
FT                   LEFEFAGKIFSMLLGPIFDQITDKMVDAFCERAEVIYGKG"
     atgacaatag taaaaaggtc aagaacagta ccttattctt gtgagcaaat gtatggactg        60
     gttaatgatg ttgaacatta ttccgagttt ctaccttatt gtgcggaaag caaaatactt       120
     catcgtgaca atgatgaagt ccaggcgact ttggtgatag cagctgctgg aatgagtaag       180
     tcattcacta ctcgtaatcg attgcaaact aataaaatga ttgaaattcg tctggttgat       240
     ggtcctttta gtcatttaga gggattttgg cgttttgatc aggaagaaaa agggtgcaga       300
     atttcttttg atttggagtt tgagtttgcc gggaaaatat tttccatgct tcttggtcct       360
     atatttgatc agataactga taaaatggtt gacgcatttt gcgaaagagc cgaggtcatt       420
     tatggtaaag gttga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page