(data stored in ACNUC7421 zone)

EMBL: CP000675.PE428

CP000675.PE428       Location/Qualifiers
FT   CDS_pept        464330..464602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2974"
FT                   /product="conserved hypothetical protein; UPF0125"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2974"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56875"
FT                   /protein_id="ABQ56875.1"
FT                   /translation="MVKVELVYIADSKNCLHYKMDLKQGATVEEALIESNIYSTCPETR
FT                   ELPVGVYGKRVSVDQVLKEGDRIEIYRPLILDPKEKRRKLAQFKK"
     atggtaaagg ttgaattagt ctatatagcg gattctaaaa attgcctgca ttacaaaatg        60
     gatttaaaac agggagctac agttgaagag gcactcattg aatcaaatat ttattcaact       120
     tgtcctgaaa cgagggaatt acctgtagga gtatacggga agcgggtttc tgtggaccag       180
     gtattgaaag aaggagatcg aattgagatt tataggccat tgatactcga ccccaaagaa       240
     aaacgccgta aattagcaca gtttaaaaaa tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page