(data stored in ACNUC7421 zone)

EMBL: CP000675.PE43

CP000675.PE43        Location/Qualifiers
FT   CDS_pept        50558..51259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54043"
FT                   /protein_id="ABQ54043.1"
FT                   /translation="MNRYSIFFLVFCAFSLESHAGLYSGINLGINAVKINKDLVYPLED
FT                   PVPTTSSFNSAYTDFHGQLIAGYDFSLTSKISAAVEANIDLFTGKARHRITEWYFDEDV
FT                   YAEEQLKVGYSLFLLPTYHLNDMVQLFVGPGVSSSRFNIAFSNTAGNVGVSDSLNEWLT
FT                   GVSIKAGSITKLTRNIDLLLTYQFTQYNSVTGVQMEPLSEDTLRGSYKPNVNTVLIGFK
FT                   VHPSDEITKDT"
     atgaatagat attccatatt ttttttagtt ttttgtgctt tttcactgga gtctcatgct        60
     ggtttgtatt ctggaattaa tttgggaatc aatgctgtta agataaataa agatcttgtc       120
     tacccgctgg aagaccctgt gccaacaact tccagtttca atagtgctta tactgatttt       180
     catggacaat tgattgcagg ctatgatttt tctcttacct caaaaatatc tgctgcagtt       240
     gaagcaaata tagacttgtt tacaggtaag gcaagacaca gaattaccga atggtatttt       300
     gatgaggatg tgtatgcaga agagcagtta aaagtaggtt attcgttatt tttgttaccc       360
     acctatcatt taaatgacat ggttcaattg tttgtaggtc caggcgtgtc atcaagtcga       420
     tttaatattg cttttagtaa tactgctgga aacgtagggg tcagtgatag tttgaatgaa       480
     tggctaaccg gggtaagcat taaggcgggt tcaataacga agctgactcg caatatagac       540
     ttacttttaa cctatcaatt cacacaatat aacagtgtta ccggagttca aatggaacct       600
     ttatccgaag atacgttgag agggagttat aagccaaacg taaacacagt gctaataggc       660
     tttaaagtac atccttcaga tgaaatcaca aaagacactt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page