(data stored in ACNUC7421 zone)

EMBL: CP000675.PE434

CP000675.PE434       Location/Qualifiers
FT   CDS_pept        468112..468711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2968"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2968"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56869"
FT                   /protein_id="ABQ56869.1"
FT                   /translation="MYSSLFLKKDLGCLPEKVIFLDFDGTVALPARKGNGEYDIQPDGS
FT                   IGATHLNKEKFRRLVQFAIQTDIPLYFLSGRPDLQSCVDLMTDFIASVDGFHSGIGGFK
FT                   KDSLFFISKMIIEEGKLVRKEITTKAQVIQSVHHEKYSYLPKESILLVDDIQEYLDPAQ
FT                   ELGYNTLLANPESLEHFDEVEKFIGVTLQKTIAFNT"
     atgtattcat cattatttct aaagaaggac ttggggtgtt tacctgaaaa agttattttt        60
     cttgattttg acggcaccgt tgctcttcct gcaaggaagg gaaatggaga atatgatatt       120
     cagcctgatg ggtcaattgg agctacccac ctaaataaag aaaaatttag acgtttagta       180
     cagtttgcta ttcaaactga tattcctttg tactttttga gcggacgtcc tgatcttcaa       240
     tcgtgtgttg atttaatgac tgattttatt gcaagcgtcg atggcttcca ttctggtatt       300
     ggcgggttta aaaaggattc tctgtttttt atcagtaaaa tgataattga agaggggaaa       360
     cttgttcgaa aggaaataac gacaaaggct caggttattc aatccgtgca tcatgaaaaa       420
     tacagttatt tacctaagga atcgatttta ctggtcgatg acattcaaga atacctcgac       480
     ccagcgcagg aactgggtta taacactttg ttggcaaatc cggagagttt ggagcatttt       540
     gatgaagtag agaaatttat tggggtaaca ttacaaaaaa ctatcgcatt caacacctag       600
//

If you have problems or comments...

PBIL Back to PBIL home page