(data stored in ACNUC7421 zone)

EMBL: CP000675.PE437

CP000675.PE437       Location/Qualifiers
FT   CDS_pept        complement(473927..475147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2965"
FT                   /product="conserved hypothetical protein; AF2307 from
FT                   Archaeoglobus fulgidus"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2965"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56866"
FT                   /protein_id="ABQ56866.1"
FT                   /translation="MSDFPIFSVLGIEIEYMLVDKESLNVQPKSDLILRTLAGHQVNEI
FT                   ELGDIAISNELVLHVLELKNNGPKPLHVPVAEHFQKTIRELQPLLAQHNLLLLPTGAHP
FT                   WMDPNTETIRWPHGNHDIYNQFNSIFNCQGHGWANLQSMHVNLPYSNEEEFCQLHNAIR
FT                   LILPLLPAIAASTPFLDGQATGLLDSRLYFYSRNQQRIPSISGDIIPEFIRTEREYQEQ
FT                   ILEPMYRDISPYDPKGILQYQWLNSRAAIPKFDMKAIEIRILDSQECVEADIAIAKAIN
FT                   AILKYWQSTSNFYLDNPCDTKSLKYVFDETIKNGLSCHIDNKKLLEQWQLPLQGMSVNT
FT                   IWSLLIERISHELDRKQQLALELILKQGNLSERILKACSSSINHDSLKQVYTQLAHCLL
FT                   RNEQFTP"
     atgtctgatt ttcctatttt ttctgtcttg gggattgaaa tagaatatat gctggtggat        60
     aaagagagtt taaatgtcca acctaaaagc gatcttattc taaggacttt ggcaggccat       120
     caggttaatg aaatagaatt aggagacatt gcgataagca atgaattagt attgcatgtc       180
     cttgagttaa aaaataatgg tcccaaacca ctacatgttc cagtagctga acatttccag       240
     aaaaccatta gagagctcca gccccttctt gctcaacaca atttattgct attacctact       300
     ggcgctcatc cctggatgga cccaaatact gaaacaattc gctggcctca tggtaaccat       360
     gatatctata atcaatttaa ttcaattttc aattgccagg gacatggctg ggcaaacttg       420
     caaagtatgc atgtcaacct gccttattcc aatgaagaag aattttgtca attgcataac       480
     gccatacgct tgattttacc tttattaccc gccattgcgg caagtactcc attccttgat       540
     ggccaagcta caggattact ggattcccgc ttgtactttt atagccgcaa tcagcaacgc       600
     attccctcca tcagcggcga tattattcct gagtttatta gaacagaaag agaatatcag       660
     gaacaaattc tcgaacccat gtatcgagac attagcccat atgatcccaa agggatatta       720
     caatatcaat ggctaaattc tcgtgctgca attcccaagt ttgacatgaa ggctattgaa       780
     attcgcattc ttgacagcca ggaatgtgta gaagcagaca ttgccatagc aaaagcaatc       840
     aatgccattt taaaatactg gcaaagcacc tcgaattttt atcttgataa tccatgcgac       900
     accaagagtt taaaatacgt ttttgatgaa accataaaaa acggattaag ttgtcatatc       960
     gataacaaaa aattactgga gcaatggcaa ttaccccttc aagggatgtc agtcaatacc      1020
     atctggtcac tattgatcga aagaattagt catgaactgg ataggaagca gcaactggct      1080
     ctggaactta ttttaaaaca gggaaatttg agtgaaagaa tcctcaaggc ttgtagctcc      1140
     agtatcaatc atgattcttt aaaacaagtg tatacgcaat tagcacattg tttgcttcgt      1200
     aatgaacaat ttaccccctg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page