(data stored in ACNUC7421 zone)

EMBL: CP000675.PE44

CP000675.PE44        Location/Qualifiers
FT   CDS_pept        complement(51328..51519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54044"
FT                   /protein_id="ABQ54044.1"
FT                   /translation="MECKCNQCGMGVKNLTCSKCDALLVSGTIVKNDGNKVQVAKCPNG
FT                   CGQIKSPVCCGHDMACSV"
     atggaatgta aatgcaatca atgtggtatg ggcgtaaaaa atttaacctg cagtaaatgt        60
     gacgcattgt tggttagtgg cactatagtc aaaaatgatg ggaataaagt tcaagtagca       120
     aaatgcccca acggatgcgg tcaaatcaaa tcacctgttt gctgcggcca cgatatggcg       180
     tgctcagtct ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page