(data stored in ACNUC7421 zone)

EMBL: CP000675.PE444

CP000675.PE444       Location/Qualifiers
FT   CDS_pept        482378..482959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2958"
FT                   /product="LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2958"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56859"
FT                   /protein_id="ABQ56859.1"
FT                   /translation="MKTFFIAILIIIALAFIWAISIYNTLIGLIEAINNNKKQIDIQLD
FT                   RRFKVFESLIEAVKKYMDYEKTTLKDVVALRNQAQAAKEAGDEQGRIAAENGISKIASN
FT                   LNLVFEQYPDLKASQNVMQLQEEIVNTENKLAYAKQAYNDGIERYNAKKKSFFESMVVA
FT                   MFSSALDKEFIYWGLPEEQIQAKENYTVKL"
     atgaaaacat tttttatcgc aattttaatt attatcgcac tcgcattcat ttgggcaatt        60
     agcatctata acactctaat cggtttgata gaggcaatta ataacaataa aaaacaaata       120
     gatattcaat tggataggcg atttaaagtt tttgaatcac tgatcgaagc agttaaaaaa       180
     tacatggatt acgaaaaaac aacattaaag gatgtcgttg ccttacgtaa tcaggctcag       240
     gctgctaaag aagcgggaga tgagcaaggt cgaattgctg cagaaaatgg aatttcaaaa       300
     attgcatcca atttgaattt ggtttttgaa cagtatcctg atttgaaagc tagccaaaat       360
     gtcatgcagt tacaagagga aattgttaac actgaaaaca agttggctta tgccaaacaa       420
     gcttataatg atgggataga acgttataac gccaagaaaa aatcattttt tgaatccatg       480
     gttgtggcaa tgttttcttc tgctttggat aaagaattta tctattgggg acttccagaa       540
     gaacaaattc aagcaaaaga aaattacact gtgaaacttt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page