(data stored in ACNUC7421 zone)

EMBL: CP000675.PE445

CP000675.PE445       Location/Qualifiers
FT   CDS_pept        482970..483989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="LPC_2957"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2957"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56858"
FT                   /protein_id="ABQ56858.1"
FT                   /translation="MGIADYHATAGDWRAQLRRNEKKTRRVIAVFFLVYILVGLIVDAF
FT                   VLQGMYPHASLENIIRALITFKVVPIATLLMIAFAGISLLITYALYDRIMLLGTEYYQI
FT                   TPETARSLQEKQLYNVVEEMKVASGLQYMPKVYIIEASYMNAFASGYSEKSAMVAITRG
FT                   LMEKLDRAEMQAVMAHELSHIRHHDIKLTLMVAVLSNILLIVIDILFYSVIYKRDRRGD
FT                   NRLLMVIIILRYVLPIITVLLALFLSRTREYMADAGCVELMRDNEPMARALLKINQDHV
FT                   QNAEQYAKAYGDTPHEQVRQASYLFDPSHIDPVKSLNNAFSTHPSIEQRLEALGFKRK"
     atggggattg cagattatca tgccacagca ggagattggc gtgctcagtt gaggcgaaat        60
     gagaaaaaga cccgaagggt gattgcagtc ttttttttag tttatatctt ggtgggattg       120
     atagtcgatg cgtttgtttt acaaggcatg tatcctcatg cttctttgga aaatattatc       180
     cgtgctttaa tcacttttaa agtggtgcct attgctactt tattaatgat cgcatttgca       240
     ggcatttctt tgttaattac ttatgctctt tatgaccgca ttatgttatt ggggacggag       300
     tactatcaaa taacgccaga aacggctcgt agcttacaag aaaagcaatt gtacaatgtt       360
     gtcgaagaga tgaaagtcgc atcgggcttg caatacatgc ctaaagttta cattatcgaa       420
     gccagttaca tgaatgcttt tgccagtggc tatagcgaga aatcggcgat ggtcgcgatt       480
     actcgtggct tgatggaaaa actggacagg gctgaaatgc aggctgtaat ggctcatgag       540
     ttaagccata tcagacatca tgatattaaa ttgactctca tggtcgccgt actaagtaac       600
     attttattaa ttgtcattga tatcctgttt tattccgtca tttacaagcg agacagaaga       660
     ggagataacc gcttgttaat ggttattatc atcttaagat acgtcttacc tattattact       720
     gttttgctag ctctcttttt aagtcgaacc agagaataca tggctgacgc cggttgtgtt       780
     gaattaatga gagataatga gcctatggcc agggctttgc ttaaaattaa tcaagaccat       840
     gttcagaatg cggaacaata tgcaaaagct tatggagata ctcctcatga gcaggtaagg       900
     caagcttcct atctttttga tccttctcac attgatcctg taaaatcgct aaataatgcc       960
     ttttcaactc atcctagcat tgagcagcgc ctggaagcat tgggttttaa acgcaaatag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page